General Information

    • DRAMP ID

    • DRAMP00892

    • Peptide Name

    • Cyclotide hyfl-I (Plant defensin)

    • Source

    • Hybanthus floribundus (Greenviolet)

    • Family

    • Belongs to the cyclotide family

    • Gene

    • Not found

    • Sequence

    • GIPCGESCVFIPCISGVIGCSCKSKVCYRN

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Not found

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Cyclotides are plant-derived miniproteins that have the unusual features of a head-to-tail cyclized peptide backbone and a knotted arrangement of disulfide bonds.

    • Helical Wheel Diagram

    • DRAMP00892 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00892.

Physicochemical Information

    • Formula

    • C132H216N36O39S6

    • Absent Amino Acids

    • ADHLMQTW

    • Common Amino Acids

    • C

    • Mass

    • 3123.74

    • PI

    • 8.33

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +2

    • Boman Index

    • -6.99

    • Hydrophobicity

    • 0.66

    • Aliphatic Index

    • 81

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 64.31

    • Polar Residues

    • 16

DRAMP00892

DRAMP00892 chydropathy plot

Comments Information

    • Function

    • Probably participates in a plant defense mechanism.

Literature Information

  • ·Literature 1

    • Title

    • A continent of plant defense peptide diversity: cyclotides in Australian Hybanthus (Violaceae).

    • Reference

    • Plant Cell. 2005 Nov;17(11):3176-3189.

    • Author

    • Simonsen SM, Sando L, Ireland DC, Colgrave ML, Bharathi R, Göransson U, Craik DJ.