• DRAMP ID

    • DRAMP00973
    • Peptide Name

    • Thionin-2.1 (Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the thionin family
    • Gene

    • THI2.1
    • Sequence

    • KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN
    • Sequence Length

    • 43
    • Evidence code

    • Transcript level
    • Biological Activity

    • Cytotoxic
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • N/A
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP00973 helical wheel diagram
    • Formula

    • C196H318N68O60S7
    • Absent Amino Acids

    • EHL
    • Common Amino Acids

    • C
    • Mass

    • 5560.84
    • PI

    • 9.21
    • Basic Residues

    • 7
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 8
    • Boman Index

    • -114.44
    • Hydrophobicity

    • -62.56
    • Aliphatic Index

    • 40.7
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 7365
    • Absorbance 280nm

    • 175.36
    • Polar Residues

    • 21

DRAMP00973

DRAMP00973 chydropathy plot
    • Function

    • Seems to function as a defense factor. Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.
    • Tissue specificity

    • Detected in rosette leaves and at a very high
  • Literature 1
    • Title

    • Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.
    • Reference

    • Nature. 2000 Dec 14;408(6814):816-820.
    • Author

    • Theologis A, Ecker JR, Palm CJ, et al.
  • Literature 2
    • Title

    • Empirical analysis of transcriptional activity in the Arabidopsis genome.
    • Reference

    • Science. 2003 Oct 31;302(5646):842-846.
    • Author

    • Yamada K, Lim J, Dale JM, et al.
  • Literature 3
    • Title

    • An Arabidopsis thaliana thionin gene is inducible via a signal transduction pathway different from that for pathogenesis-related proteins.
    • Reference

    • Plant Physiol. 1995 Nov;109(3):813-820.
    • Author

    • Epple P, Apel K, Bohlmann H.