General Information

    • DRAMP ID

    • DRAMP00973

    • Peptide Name

    • Thionin-2.1 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the thionin family

    • Gene

    • THI2.1

    • Sequence

    • KICCPSNQARNGYSVCRIRFSKGRCMQVSGCQNSDTCPRGWVN

    • Sequence Length

    • 43

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00973 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00973.

Physicochemical Information

    • Formula

    • C196H318N68O60S7

    • Absent Amino Acids

    • EHL

    • Common Amino Acids

    • C

    • Mass

    • 4811.52

    • PI

    • 9.43

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +6

    • Boman Index

    • -114.44

    • Hydrophobicity

    • -0.626

    • Aliphatic Index

    • 40.7

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7365

    • Absorbance 280nm

    • 175.36

    • Polar Residues

    • 21

DRAMP00973

DRAMP00973 chydropathy plot

Comments Information

    • Function

    • Seems to function as a defense factor. Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • Tissue specificity

    • Detected in rosette leaves and at a very high

Literature Information

  • ·Literature 1

    • Title

    • Sequence and analysis of chromosome 1 of the plant Arabidopsis thaliana.

    • Reference

    • Nature. 2000 Dec 14;408(6814):816-820.

    • Author

    • Theologis A, Ecker JR, Palm CJ, et al.
  • ·Literature 2

    • Title

    • Empirical analysis of transcriptional activity in the Arabidopsis genome.

    • Reference

    • Science. 2003 Oct 31;302(5646):842-846.

    • Author

    • Yamada K, Lim J, Dale JM, et al.
  • ·Literature 3

    • Title

    • An Arabidopsis thaliana thionin gene is inducible via a signal transduction pathway different from that for pathogenesis-related proteins.

    • Reference

    • Plant Physiol. 1995 Nov;109(3):813-820.

    • Author

    • Epple P, Apel K, Bohlmann H.