General Information

    • DRAMP ID

    • DRAMP00974

    • Peptide Name

    • Thionin-2.2 (Plant defensin)

    • Source

    • Arabidopsis thaliana (Mouse-ear cress)

    • Family

    • Belongs to the thionin family

    • Gene

    • THI2.2

    • Sequence

    • KICCPTKDDRSVYFVCMLSVSSQFYCLLKSKCKNTSQTICPPGYTN

    • Sequence Length

    • 46

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Cytotoxic

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00974 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00974.

Physicochemical Information

    • Formula

    • C226H360N58O68S7

    • Absent Amino Acids

    • AEHW

    • Common Amino Acids

    • CS

    • Mass

    • 5202.11

    • PI

    • 8.86

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -61.92

    • Hydrophobicity

    • -0.135

    • Aliphatic Index

    • 61.3

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 107.67

    • Polar Residues

    • 22

DRAMP00974

DRAMP00974 chydropathy plot

Comments Information

    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.

    • PTM

    • Contains three disulfide bonds 3-40;4-32;16-26.

    • Tissue specificity

    • Low basal expression in seedlings. Also detected in rosette leaves.

Literature Information

  • ·Literature 1

    • Title

    • An Arabidopsis thaliana thionin gene is inducible via a signal transduction pathway different from that for pathogenesis-related proteins.

    • Reference

    • Plant Physiol. 1995 Nov;109(3):813-820.

    • Author

    • Epple P, Apel K, Bohlmann H.
  • ·Literature 2

    • Title

    • Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones.

    • Reference

    • DNA Res. 1998 Dec 31;5(6):379-391.

    • Author

    • Asamizu E, Sato S, Kaneko T, Nakamura Y, Kotani H, Miyajima N, Tabata S.