• DRAMP ID

    • DRAMP00974
    • Peptide Name

    • Thionin-2.2 (Plant defensin)
    • Source

    • Arabidopsis thaliana (Mouse-ear cress)
    • Family

    • Belongs to the thionin family
    • Gene

    • THI2.2
    • Sequence

    • KICCPTKDDRSVYFVCMLSVSSQFYCLLKSKCKNTSQTICPPGYTN
    • Sequence Length

    • 46
    • Evidence code

    • Transcript level
    • Biological Activity

    • Cytotoxic
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • N/A
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • N/A
    • DRAMP00974 helical wheel diagram
    • Formula

    • C226H360N58O68S7
    • Absent Amino Acids

    • AEHW
    • Common Amino Acids

    • CS
    • Mass

    • 6004.94
    • PI

    • 8.61
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -61.92
    • Hydrophobicity

    • -13.48
    • Aliphatic Index

    • 61.3
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 4845
    • Absorbance 280nm

    • 107.67
    • Polar Residues

    • 22

DRAMP00974

DRAMP00974 chydropathy plot
    • Function

    • Thionins are small plant proteins which are toxic to animal cells. They seem to exert their toxic effect at the level of the cell membrane.
    • PTM

    • Contains three disulfide bonds 3-40;4-32;16-26.
    • Tissue specificity

    • Low basal expression in seedlings. Also detected in rosette leaves.
  • Literature 1
    • Title

    • An Arabidopsis thaliana thionin gene is inducible via a signal transduction pathway different from that for pathogenesis-related proteins.
    • Reference

    • Plant Physiol. 1995 Nov;109(3):813-820.
    • Author

    • Epple P, Apel K, Bohlmann H.
  • Literature 2
    • Title

    • Structural analysis of Arabidopsis thaliana chromosome 5. VIII. Sequence features of the regions of 1,081,958 bp covered by seventeen physically assigned P1 and TAC clones.
    • Reference

    • DNA Res. 1998 Dec 31;5(6):379-391.
    • Author

    • Asamizu E, Sato S, Kaneko T, Nakamura Y, Kotani H, Miyajima N, Tabata S.