• DRAMP ID

    • DRAMP00981
    • Peptide Name

    • Antimicrobial peptide 1b (WAMP-1b; Plant defensin)
    • Source

    • Triticum kiharae (wheat)
    • Family

    • Belongs to the hevein-like family
    • Gene

    • Not found
    • Sequence

    • AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGCR
    • Sequence Length

    • 45
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Fungi: Bipolaris sorokiniana (IC50=5 µg/ml), Botrytis cinerea (IC50=20 µg/ml), Fusarium oxysporum (IC50=5 µg/ml), F. solani (IC50=5 µg/ml), F. verticillioides (IC50=30 µg/ml), Neurospora crassa (IC50=10 µg/ml);
      • Gram-positive bacterium: Clavibacter michiganensis (1.3cm inhibition for 2.5 µg/50µl);
      • Gram-negative bacteria:
        Target OrganismActivity
        Erwinia carotovora1.1cm for 2.5 µg/50µl
        Pseudomonas syringae0.9cm for 2.5 µg/50µl
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Chitin-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP00981 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP00981.
    • Formula

    • C178H284N64O60S10
    • Absent Amino Acids

    • EHIMTVW
    • Common Amino Acids

    • C
    • Mass

    • 4601.21
    • PI

    • 8.62
    • Basic Residues

    • 6
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +4
    • Boman Index

    • -89.29
    • Hydrophobicity

    • -0.442
    • Aliphatic Index

    • 19.78
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3605
    • Absorbance 280nm

    • 81.93
    • Polar Residues

    • 25

DRAMP00981

DRAMP00981 chydropathy plot
    • PTM

    • Contains five disulfide bonds 4-19; 13-25; 16-44; 18-32; 37-41.
  • ·Literature 1
    • Title

    • A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif.
    • Reference

    • FEBS J. 2009 Aug;276(15):4266-4275.
    • Author

    • Odintsova TI, Vassilevski AA, Slavokhotova AA, Musolyamov AK, Finkina EI, Khadeeva NV, Rogozhin EA, Korostyleva TV, Pukhalsky VA, Grishin EV, Egorov TA.
  • ·Literature 2
    • Title

    • Diversity of wheat anti-microbial peptides.
    • Reference

    • Peptides. 2005 Nov;26(11):2064-2073.
    • Author

    • Egorov TA, Odintsova TI, Pukhalsky VA, Grishin EV.