• DRAMP ID

    • DRAMP00992
    • Peptide Name

    • Sm-AMP-D2 (Plant defensin)
    • Source

    • Stellaria media L (Common chickweed seeds)
    • Family

    • N/A
    • Gene

    • N/A
    • Sequence

    • KICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFNC
    • Sequence Length

    • 50
    • Swiss_Prot Entry

    • No entry found
    • Evidence code

    • N/A
    • Biological Activity

    • Antifungal, Antimicrobial
    • Target Organism

      • Fungi: Fusarium oxysporum 16/10 (IC50=0.5 µM), Botrytis cinerea SGR-1 (IC50=0.35 µM), Bipolaris sorokiniana 6/10 (IC50=0.52 µM), Fusarium graminearum VKM F-1668 (IC50=0.52 µM), Fusarium avenaceum VKM F-2303 (IC50=1 µM), Phoma betae VKM F-2532 (IC50=0.52 µM), Pythium debaryanum VKMF-1505 (IC50=1 µM).
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • N/A
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Other Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP00992 helical wheel diagram
    • Formula

    • C247H356N70O73S9
    • Absent Amino Acids

    • L
    • Common Amino Acids

    • C
    • Mass

    • 6636.71
    • PI

    • 7.66
    • Basic Residues

    • 6
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 11
    • Boman Index

    • -78.37
    • Hydrophobicity

    • -44.6
    • Aliphatic Index

    • 33.2
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 15970
    • Absorbance 280nm

    • 325.92
    • Polar Residues

    • 26

DRAMP00992

DRAMP00992 chydropathy plot
    • Function

    • Sm-AMP-D defensins displays strong antifungal activity against important plant pathogens being active at very low concentrations (IC50=1 M).
  • Literature 1
    • Title

    • Isolation, molecular cloning and antimicrobial activity of novel defensins from common chickweed (Stellaria media L.) seeds.
    • Reference

    • Biochimie. 2011 Mar;93(3):450-456.
    • Author

    • Slavokhotova AA, Odintsova TI, Rogozhin EA, Musolyamov AK, Andreev YA, Grishin EV, Egorov TA.