General Information

    • DRAMP ID

    • DRAMP00992

    • Peptide Name

    • Sm-AMP-D2 (Plant defensin)

    • Source

    • Stellaria media L (Common chickweed seeds)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KICERASGTWKGICIHSNDCNNQCVKWENAGSGSCHYQFPNYMCFCYFNC

    • Sequence Length

    • 50

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Fusarium oxysporum 16/10 (IC50=0.5 µM), Botrytis cinerea SGR-1 (IC50=0.35 µM), Bipolaris sorokiniana 6/10 (IC50=0.52 µM), Fusarium graminearum VKM F-1668 (IC50=0.52 µM), Fusarium avenaceum VKM F-2303 (IC50=1 µM), Phoma betae VKM F-2532 (IC50=0.52 µM), Pythium debaryanum VKMF-1505 (IC50=1 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP00992 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP00992.

Physicochemical Information

    • Formula

    • C247H356N70O73S9

    • Absent Amino Acids

    • L

    • Common Amino Acids

    • C

    • Mass

    • 5762.51

    • PI

    • 7.71

    • Basic Residues

    • 6

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +3

    • Boman Index

    • -78.37

    • Hydrophobicity

    • -0.446

    • Aliphatic Index

    • 33.2

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 15970

    • Absorbance 280nm

    • 325.92

    • Polar Residues

    • 26

DRAMP00992

DRAMP00992 chydropathy plot

Comments Information

    • Function

    • Sm-AMP-D defensins displays strong antifungal activity against important plant pathogens being active at very low concentrations (IC50=1 M).

Literature Information

  • ·Literature 1

    • Title

    • Isolation, molecular cloning and antimicrobial activity of novel defensins from common chickweed (Stellaria media L.) seeds.

    • Reference

    • Biochimie. 2011 Mar;93(3):450-456.

    • Author

    • Slavokhotova AA, Odintsova TI, Rogozhin EA, Musolyamov AK, Andreev YA, Grishin EV, Egorov TA.