General Information

    • DRAMP ID

    • DRAMP01014

    • Peptide Name

    • VrD1 (V.radiata defensin 1; Plants)

    • Source

    • Vigna radiata

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC

    • Sequence Length

    • 46

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

      • Fungi: Fusarium oxysporum, Pyricularia oryza, Rhizoctonia solani, Trichophyton rubrum, bruchid larva.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01014 helical wheel diagram

    • PDB ID

    • 1TI5 resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP01014.

Physicochemical Information

    • Formula

    • C211H348N66O62S10

    • Absent Amino Acids

    • FPQ

    • Common Amino Acids

    • C

    • Mass

    • 5122.09

    • PI

    • 9.06

    • Basic Residues

    • 9

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 8

    • Net Charge

    • +7

    • Boman Index

    • -75.79

    • Hydrophobicity

    • -0.283

    • Aliphatic Index

    • 50.87

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 8980

    • Absorbance 280nm

    • 199.56

    • Polar Residues

    • 25

DRAMP01014

DRAMP01014 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Cloning and functional expression of a mungbean defensin VrD1 in Pichia pastoris.

    • Reference

    • J Agric Food Chem 2004; 52: 2256-2261.

    • Author

    • Chen JJ et al Chen CS.