General Information

    • DRAMP ID

    • DRAMP01021

    • Peptide Name

    • Antimicrobial peptide 1a (LAMP-1a; Plant defensin)

    • Source

    • Leymus arenarius (Lyme grass) (Elymus arenarius)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • AQKCGEQGRGAKCPNCLCCGRYGFCGSTPDYCGVGCQSQCRGC

    • Sequence Length

    • 43

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01021 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01021.

Physicochemical Information

    • Formula

    • C175H277N59O58S10

    • Absent Amino Acids

    • HIMW

    • Common Amino Acids

    • C

    • Mass

    • 4456.08

    • PI

    • 8.41

    • Basic Residues

    • 5

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +3

    • Boman Index

    • -73.02

    • Hydrophobicity

    • -0.421

    • Aliphatic Index

    • 20.47

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3605

    • Absorbance 280nm

    • 85.83

    • Polar Residues

    • 25

DRAMP01021

DRAMP01021 chydropathy plot

Comments Information

    • PTM

    • Contains five disulfide bonds 4-19; 13-25; 16-43; 18-32; 36-40.

Literature Information

  • ·Literature 1

    • Title

    • Unknown

    • Reference

    • Submitted (APR-2010) to UniProtKB

    • Author

    • Odintsova TI.