General Information

    • DRAMP ID

    • DRAMP01027

    • Peptide Name

    • MiAMP2c (Gln- and Glu-rich; Plant defensin)

    • Source

    • Macadamia integrifolia (Macadamia nut)

    • Family

    • Belongs to the vicilin-like family

    • Gene

    • Not found

    • Sequence

    • RQRDPQQQYEQCQKHCQRRETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDN

    • Sequence Length

    • 68

    • UniProt Entry

    • No entry found

    • Protein Existence

    • Not found

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Rich

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01027 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01027.

Physicochemical Information

    • Formula

    • C363H584N130O126S6

    • Absent Amino Acids

    • AFGILSVW

    • Common Amino Acids

    • EQ

    • Mass

    • 8977.79

    • PI

    • 7.85

    • Basic Residues

    • 21

    • Acidic Residues

    • 18

    • Hydrophobic Residues

    • 0

    • Net Charge

    • +3

    • Boman Index

    • -435.6

    • Hydrophobicity

    • -2.929

    • Aliphatic Index

    • 0

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 6210

    • Absorbance 280nm

    • 92.69

    • Polar Residues

    • 11

DRAMP01027

DRAMP01027 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A family of antimicrobial peptides is produced by processing of a 7S globulin protein in Macadamia integrifolia kernels.

    • Reference

    • Plant J. 1999 Sep;19(6):699-710.

    • Author

    • Marcus JP, Green JL, Goulter KC, Manners JM.