• DRAMP ID

    • DRAMP01027
    • Peptide Name

    • MiAMP2c (Gln- and Glu-rich; Plant defensin)
    • Source

    • Macadamia integrifolia (Macadamia nut)
    • Family

    • Belongs to the vicilin-like family
    • Gene

    • Not found
    • Sequence

    • RQRDPQQQYEQCQKHCQRRETEPRHMQTCQQRCERRYEKEKRKQQKRYEEQQREDEEKYEERMKEEDN
    • Sequence Length

    • 68
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Rich
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01027 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01027.
    • Formula

    • C363H584N130O126S6
    • Absent Amino Acids

    • AFGILSVW
    • Common Amino Acids

    • EQ
    • Mass

    • 8977.79
    • PI

    • 7.85
    • Basic Residues

    • 21
    • Acidic Residues

    • 18
    • Hydrophobic Residues

    • 0
    • Net Charge

    • +3
    • Boman Index

    • -435.6
    • Hydrophobicity

    • -2.929
    • Aliphatic Index

    • 0
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 6210
    • Absorbance 280nm

    • 92.69
    • Polar Residues

    • 11

DRAMP01027

DRAMP01027 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • A family of antimicrobial peptides is produced by processing of a 7S globulin protein in Macadamia integrifolia kernels.
    • Reference

    • Plant J. 1999 Sep;19(6):699-710.
    • Author

    • Marcus JP, Green JL, Goulter KC, Manners JM.