• DRAMP ID

    • DRAMP01072
    • Peptide Name

    • Non-specific lipid-transfer protein (Plants)
    • Source

    • Zea mays subsp. parviglumis (Balsas teosinte)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • plt1
    • Sequence

    • AISCGQVASAIAPCISYARGQGSGPSAGCCSGVKSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
    • Sequence Length

    • 93
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Lipid-binding
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C368H616N120O128S8
    • Absent Amino Acids

    • EFHMW
    • Common Amino Acids

    • A
    • Mass

    • 9026.15
    • PI

    • 9.1
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 31
    • Net Charge

    • +6
    • Boman Index

    • -112.09
    • Hydrophobicity

    • 0.103
    • Aliphatic Index

    • 71.61
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 37.83
    • Polar Residues

    • 46

DRAMP01072

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
  • ·Literature 1
    • Title

    • Genetic diversity and the evolutionary history of plant immunity genes in two species of Zea.
    • Reference

    • Mol Biol Evol. 2005 Dec;22(12):2480-2490.
    • Author

    • Moeller DA, Tiffin P.