• DRAMP ID

    • DRAMP01074
    • Peptide Name

    • Non-specific lipid-transfer protein (Plants)
    • Source

    • Secale cereale (Rye)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • N/A
    • Sequence

    • AISCGQVNSALGPCISYARGSGANTSAACCSGVKRLAGSVRTSDDKKAACLCIKRAAGGLNPGKAADIPTKCRVTIPYKISSNVNCNNLH
    • Sequence Length

    • 90
    • Evidence code

    • Homology
    • Biological Activity

    • Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

    • Binding Target

    • Lipid-binding
    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP01074 helical wheel diagram
    • Formula

    • C379H640N122O121S8
    • Absent Amino Acids

    • EFMW
    • Common Amino Acids

    • A
    • Mass

    • 10000
    • PI

    • 9.53
    • Basic Residues

    • 13
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 29
    • Boman Index

    • -124.3
    • Hydrophobicity

    • -5
    • Aliphatic Index

    • 78.22
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 39.1
    • Polar Residues

    • 40

DRAMP01074

DRAMP01074 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
  • Literature 1
    • Reference

    • Nat Biotechnol. 2006 Jul;24(7):852-855.
    • Author

    • Doxey AC, Yaish MW, Griffith M, McConkey BJ.
    • Title

    • Ordered surface carbons distinguish antifreeze proteins and their ice-binding regions.