General Information

    • DRAMP ID

    • DRAMP01077

    • Peptide Name

    • Non-specific lipid-transfer protein (Plants)

    • Source

    • Oryza sativa subsp. japonica (Rice)

    • Family

    • Belongs to the plant LTP family

    • Gene

    • Not found

    • Sequence

    • AITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLKAAASSTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS

    • Sequence Length

    • 92

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Lipid-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01077 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01077.

Physicochemical Information

    • Formula

    • C369H624N120O123S8

    • Absent Amino Acids

    • EFHMW

    • Common Amino Acids

    • A

    • Mass

    • 8966.22

    • PI

    • 9.41

    • Basic Residues

    • 10

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 32

    • Net Charge

    • +8

    • Boman Index

    • -106.3

    • Hydrophobicity

    • 0.174

    • Aliphatic Index

    • 75.54

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3480

    • Absorbance 280nm

    • 38.24

    • Polar Residues

    • 43

DRAMP01077

DRAMP01077 chydropathy plot

Comments Information

    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.

    • Reference

    • BMC Biol. 2005 Sep 27;3:20.

    • Author

    • Rice Chromosomes 11 and 12 Sequencing Consortia.