• DRAMP ID

    • DRAMP01078
    • Peptide Name

    • Non-specific lipid-transfer protein (Plants)
    • Source

    • Zea mays (Maize)
    • Family

    • Belongs to the plant LTP family
    • Gene

    • N/A
    • Sequence

    • AITCGQVSSAIAPCLSYARGTGSGPSASCCSGVRNLKSAASTAADRRAACNCLKNAARGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN
    • Sequence Length

    • 93
    • Evidence code

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

      • No MICs found on DRAMP database
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

    • Binding Target

    • Lipid-binding
    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP01078 helical wheel diagram
    • Formula

    • C370H623N121O129S8
    • Absent Amino Acids

    • EFHMW
    • Common Amino Acids

    • AS
    • Mass

    • 10000
    • PI

    • 9
    • Basic Residues

    • 9
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 30
    • Boman Index

    • -126.95
    • Hydrophobicity

    • 8.28
    • Aliphatic Index

    • 70.54
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3480
    • Absorbance 280nm

    • 37.83
    • Polar Residues

    • 47

DRAMP01078

DRAMP01078 chydropathy plot
    • Function

    • Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity).
  • Literature 1
    • Reference

    • PLoS Genet. 2009 Nov;5(11):e1000740.
    • Author

    • Soderlund C, Descour A, Kudrna D, Bomhoff M, Boyd L, Currie J, Angelova A, Collura K, Wissotski M, Ashley E, Morrow D, Fernandes J, Walbot V, Yu Y.
    • Title

    • Sequencing, mapping, and analysis of 27,455 maize full-length cDNAs.