General Information

    • DRAMP ID

    • DRAMP01274

    • Peptide Name

    • Kunitz-type serine protease inhibitor PIVL;

    • Source

    • Macrovipera lebetina transmediterranea (Blunt-nosed viper) (Viperalebetina transmediterranea)

    • Family

    • Belongs to the venom Kunitz-type family

    • Gene

    • Not found

    • Sequence

    • QDRPKFCYLPADPAECNAYMPRFYYDSASNKCKEFIYGGCRGNANNFKNRAECRHTCVAS

    • Sequence Length

    • 60

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antitumor

    • Target Organism

    • IC50=250 nM on fibrinogen and 300 nM on fibronectin of glioblastoma cell line U87

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01274 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C297H442N88O89S7

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • ACN

    • Mass

    • 6893.73

    • PI

    • 8.61

    • Basic Residues

    • 10

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -15558

    • Hydrophobicity

    • -0.847

    • Aliphatic Index

    • 29.5

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7825

    • Absorbance 280nm

    • 132.63

    • Polar Residues

    • 24

DRAMP01274

DRAMP01274 chydropathy plot

Comments Information

    • Function

    • Serine protease inhibitor that inhibits trypsin. Exhibits an anti-tumor effect and displays integrin inhibitory activity without being cytotoxiC. Is able to dose-dependently inhibit the adhesion, migration and invasion of human glioblastoma U87 cellS. Also impairs the function of alphavbeta3 and to a lesser extent, the activity of alphavbeta6, alphavbeta5, alpha1beta1 and alpha5beta1 integrinS. ##Miscellaneous

Literature Information

  • ·Literature 1

    • Title

    • PIVL, a new serine protease inhibitor from Macrovipera lebetinatransmediterranea venom, impairs motility of human glioblastomacellS.

    • Reference

    • Matrix Biol. 32:52-62 (2013).

    • Author

    • Morjen M. , Kallech-Ziri O., Bazaa A., Othman H., Mabrouk K., Zouari-Kessentini R., Sanz L., Calvete J.J., Srairi-Abid N., El Ayeb M. , Luis J., Marrakchi N.