• DRAMP ID

    • DRAMP01467
    • Peptide Name

    • Esculentin-2Rb (Frogs, amphibians, animals)
    • Source

    • Rana ridibunda (Laughing frog) (Marsh frog)
    • Family

    • Belongs to the frog skin active peptide family (Brevinin subfamily)
    • Gene

    • Not found
    • Sequence

    • GIFSLVKGVAKLAGKTLAKEGGKFGLELAMCKIAKQC
    • Sequence Length

    • 37
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP01467 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01467.
    • Formula

    • C172H295N45O45S3
    • Absent Amino Acids

    • DHNPRWY
    • Common Amino Acids

    • K
    • Mass

    • 3809.69
    • PI

    • 9.7
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +5
    • Boman Index

    • 4.1
    • Hydrophobicity

    • 0.438
    • Aliphatic Index

    • 102.97
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 125
    • Absorbance 280nm

    • 3.47
    • Polar Residues

    • 10

DRAMP01467

DRAMP01467 chydropathy plot
    • Function

    • Antimicrobial peptide.
    • Tissue specificity

    • Expressed by the skin glands.
    • PTM

    • Contains one disulfide bond 31-37.
  • ·Literature 1
    • Title

    • De novo sequencing of peptides secreted by the skin glands of the Caucasian Green Frog Rana ridibunda.
    • Reference

    • Rapid Commun Mass Spectrom. 2008 Nov;22(22):3517-3525.
    • Author

    • Samgina TY, Artemenko KA, Gorshkov VA, Ogourtsov SV, Zubarev RA, Lebedev AT.