General Information

    • DRAMP ID

    • DRAMP01675

    • Peptide Name

    • Dermaseptin-3 (DStar 03; Frogs, amphibians, animals)

    • Source

    • Phyllomedusa tarsius (Brownbelly leaf frog)

    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)

    • Gene

    • Not found

    • Sequence

    • GLFKTLIKGAGKMLGHVAKQFLGSQGQPES

    • Sequence Length

    • 30

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal

    • Target Organism

      • [Swiss_Prot Entry P84923]Gram-positive bacteria: Staphylococcus aureus, Enterococcus faecalis;
      • Gram-neagtive bacterium: Pseudomonas aeruginosa;
      • Fungi: Candida albicans and Paracoccidioides brasiliensis.

    • Hemolytic Activity

      • [Ref:PubMed ID is not available]100% hemolytic activity at 128 µg/ml

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01675 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01675.

Physicochemical Information

    • Formula

    • C141H231N39O39S

    • Absent Amino Acids

    • CDNRWY

    • Common Amino Acids

    • G

    • Mass

    • 3128.68

    • PI

    • 10

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -13.45

    • Hydrophobicity

    • -0.137

    • Aliphatic Index

    • 81.33

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 9

DRAMP01675

DRAMP01675 chydropathy plot

Comments Information

    • Function

    • Antimicrobial peptide, active against the Gram-positive bacterium S. aureus, the Gram-negative bacteria E. coli and P. aeruginosa, and the yeasts C. albicans and P. brasiliensis. Has hemolytic activity.

    • Tissue specificity

    • Expressed by the skin glands.

Literature Information

  • ·Literature 1

    • Title

    • Dermaseptins and phylloseptins from Phyllomedusa tarsius (Amphibia).

    • Reference

    • Submitted (AUG-2006) to UniProtKB.

    • Author

    • Prates M.V, Jardim D.P, Silva L.P, Gordo M, Leite J.R.S.A, Figueredo R.C.R, Amaral A.C, Felipe M.S.S, Bloch C. Jr.