• DRAMP ID

    • DRAMP01675
    • Peptide Name

    • Dermaseptin-3 (DStar 03; Frogs, amphibians, animals)
    • Source

    • Phyllomedusa tarsius (Brownbelly leaf frog)
    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)
    • Gene

    • Not found
    • Sequence

    • GLFKTLIKGAGKMLGHVAKQFLGSQGQPES
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Antifungal
    • Target Organism

      • [Swiss_Prot Entry P84923]Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus-
        Enterococcus faecalis;-
      • Gram-neagtive bacterium:
        Target OrganismActivity
        Pseudomonas aeruginosa;-
      • Fungi:
        Target OrganismActivity
        Candida albicans and Paracoccidioides brasiliensis-
    • Hemolytic Activity

      • [Ref:PubMed ID is not available]100% hemolytic activity at 128 µg/ml
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP01675.
    • Formula

    • C141H231N39O39S
    • Absent Amino Acids

    • CDNRWY
    • Common Amino Acids

    • G
    • Mass

    • 3128.68
    • PI

    • 10
    • Basic Residues

    • 5
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +4
    • Boman Index

    • -13.45
    • Hydrophobicity

    • -0.137
    • Aliphatic Index

    • 81.33
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 9

DRAMP01675

    • Function

    • Antimicrobial peptide, active against the Gram-positive bacterium S. aureus, the Gram-negative bacteria E. coli and P. aeruginosa, and the yeasts C. albicans and P. brasiliensis. Has hemolytic activity.
    • Tissue specificity

    • Expressed by the skin glands.
  • ·Literature 1
    • Title

    • Dermaseptins and phylloseptins from Phyllomedusa tarsius (Amphibia).
    • Reference

    • Submitted (AUG-2006) to UniProtKB.
    • Author

    • Prates M.V, Jardim D.P, Silva L.P, Gordo M, Leite J.R.S.A, Figueredo R.C.R, Amaral A.C, Felipe M.S.S, Bloch C. Jr.