General Information

    • DRAMP ID

    • DRAMP01692

    • Peptide Name

    • Dermaseptin PD-2-2 (Frogs, amphibians, animals)

    • Source

    • Pachymedusa dacnicolor (Giant mexican leaf frog)

    • Family

    • Belongs to the frog skin active peptide family (Dermaseptin subfamily)

    • Gene

    • Not found

    • Sequence

    • ALWKTLLKKVGKVAGKAVLNAVTNMANQNEQ

    • Sequence Length

    • 31

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP01692 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP01692.

Physicochemical Information

    • Formula

    • C148H253N43O42S

    • Absent Amino Acids

    • CDFHIPRSY

    • Common Amino Acids

    • AK

    • Mass

    • 3338.96

    • PI

    • 10.18

    • Basic Residues

    • 5

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +4

    • Boman Index

    • -25.89

    • Hydrophobicity

    • -0.136

    • Aliphatic Index

    • 103.87

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 183.33

    • Polar Residues

    • 8

DRAMP01692

DRAMP01692 chydropathy plot

Comments Information

    • MOA

    • Probably acts by disturbing membrane functions with its amphipathic structure (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Cloning of cDNAs encoding new peptides of the dermaseptin-family.

    • Reference

    • Biochim Biophys Acta. 1998 Oct 14;1388(1):279-283.

    • Author

    • Wechselberger C.