General Information

    • DRAMP ID

    • DRAMP02299

    • Peptide Name

    • Gaegurin-6-RN antimicrobial peptide (Frogs, amphibians, animals)

    • Source

    • Rana nigrovittata (black-striped frog)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • FTMKKSLLLLFFLGTINLSLCEKERNAEEEKRDGDDETDVEVQK

    • Sequence Length

    • 44

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

      • Comment: No comments found on DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02299 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02299.

Physicochemical Information

    • Formula

    • C224H364N58O75S2

    • Absent Amino Acids

    • HPWY

    • Common Amino Acids

    • EL

    • Mass

    • 5133.82

    • PI

    • 4.58

    • Basic Residues

    • 7

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 14

    • Net Charge

    • -4

    • Boman Index

    • -109.77

    • Hydrophobicity

    • -0.634

    • Aliphatic Index

    • 86.36

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 10

DRAMP02299

DRAMP02299 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Peptidomics and genomics analysis of novel antimicrobial peptides from the frog, Rana nigrovittata.

    • Reference

    • Genomics. 2010 Jan;95(1):66-71.

    • Author

    • Ma Y, Liu C, Liu X, Wu J, Yang H, Wang Y, Li J, Yu H, Lai R.