General Information

    • DRAMP ID

    • DRAMP02571

    • Peptide Name

    • Penaeidin-2a (Pen-2a; shrimps, Arthropods, animals)

    • Source

    • Litopenaeus vannamei (Whiteleg shrimp) (Penaeus vannamei)

    • Family

    • Belongs to the penaeidin family

    • Gene

    • Not found

    • Sequence

    • YRGGYTGPIPRPPPIGRPPFRPVCNACYRLSVSDARNCCIKFGSCCHLVK

    • Sequence Length

    • 50

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Micrococcus luteus;
      • Gram-negative bacterium: Escherichia coli.
      • Fungi: Neurospora crassa, Fusarium oxysporum, Saccharomyces cerevisiae TGY.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Chitin-binding

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02571 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02571.

Physicochemical Information

    • Formula

    • C243H382N74O62S6

    • Absent Amino Acids

    • EMQW

    • Common Amino Acids

    • P

    • Mass

    • 5524.52

    • PI

    • 9.55

    • Basic Residues

    • 9

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +8

    • Boman Index

    • -81.79

    • Hydrophobicity

    • -0.248

    • Aliphatic Index

    • 60.4

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:10 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 98.88

    • Polar Residues

    • 20

DRAMP02571

DRAMP02571 chydropathy plot

Comments Information

    • Subcellular location

    • Cytoplasmic granule. Note

    • Tissue specificity

    • Higher expression in hemocytes and to a lesser extent in heart, testis, gills, intestine, lymphonoid organ and hepatopancreas. Traces in eyes and subcuticular epithelium. Not present in the brain.

    • Developmental stage

    • Expression decreases 3 hours after microbial challenge to return to control levels after 12 hours and slightly increases after 24 hours.

    • PTM

    • Contains three disulfide bonds 24-38; 27-45; 39-46 and Lysine amide at position 50.

Literature Information

  • ·Literature 1

    • Title

    • Penaeidins, a family of antimicrobial peptides from penaeid shrimp (Crustacea, Decapoda).

    • Reference

    • Cell Mol Life Sci. 2000 Aug;57(8-9):1260-1271.

    • Author

    • Destoumieux D, Munoz M, Bulet P, Bachère E.
  • ·Literature 2

    • Title

    • Penaeidins, a new family of antimicrobial peptides isolated from the shrimp Penaeus vannamei (Decapoda).

    • Reference

    • J Biol Chem. 1997 Nov 7;272(45):28398-28406.

    • Author

    • Destoumieux D, Bulet P, Loew D, Van Dorsselaer A, Rodriguez J, Bachère E.
  • ·Literature 3

    • Title

    • Recombinant expression and range of activity of penaeidins, antimicrobial peptides from penaeid shrimp.

    • Reference

    • Eur J Biochem. 1999 Dec;266(2):335-346.

    • Author

    • Destoumieux D, Bulet P, Strub JM, Van Dorsselaer A, Bachère E.