General Information

    • DRAMP ID

    • DRAMP02697

    • Peptide Name

    • Defensin-5 (Defensin, alpha 5; primates, mammals, animals)

    • Source

    • Pan troglodytes (Chimpanzee)

    • Family

    • Not found

    • Gene

    • DEFA5

    • Sequence

    • ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRIGHCTILESLSGVCEISGRLYRLCCR

    • Sequence Length

    • 75

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02697 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02697.

Physicochemical Information

    • Formula

    • C333H548N106O117S6

    • Absent Amino Acids

    • MPW

    • Common Amino Acids

    • SL

    • Mass

    • 8101.01

    • PI

    • 5.73

    • Basic Residues

    • 9

    • Acidic Residues

    • 9

    • Hydrophobic Residues

    • 21

    • Net Charge

    • 0

    • Boman Index

    • -173.39

    • Hydrophobicity

    • -0.369

    • Aliphatic Index

    • 75.6

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 45.34

    • Polar Residues

    • 31

DRAMP02697

DRAMP02697 chydropathy plot

Comments Information

    • Function

    • Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. All DEFA5 peptides exert antimicrobial activities, but their potency is affected by peptide processing (By similarity).

    • Subcellular location

    • Secreted. Cytoplasmic vesicle › secretory vesicle (By similarity). Note

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.

    • Reference

    • Physiol Genomics. 2004 Dec 15;20(1):1-11.

    • Author

    • Patil A, Hughes AL, Zhang G.