• DRAMP ID

    • DRAMP02697
    • Peptide Name

    • Defensin-5 (Defensin, alpha 5; primates, mammals, animals)
    • Source

    • Pan troglodytes (Chimpanzee)
    • Family

    • Not found
    • Gene

    • DEFA5
    • Sequence

    • ESLQERADEATTQKQSGEDNQDLAISFAGNGLSALRTSGSQARATCYCRIGHCTILESLSGVCEISGRLYRLCCR
    • Sequence Length

    • 75
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C333H548N106O117S6
    • Absent Amino Acids

    • MPW
    • Common Amino Acids

    • SL
    • Mass

    • 8101.01
    • PI

    • 5.73
    • Basic Residues

    • 9
    • Acidic Residues

    • 9
    • Hydrophobic Residues

    • 21
    • Net Charge

    • 0
    • Boman Index

    • -173.39
    • Hydrophobicity

    • -0.369
    • Aliphatic Index

    • 75.6
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 45.34
    • Polar Residues

    • 31

DRAMP02697

DRAMP02697 chydropathy plot
    • Function

    • Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. All DEFA5 peptides exert antimicrobial activities, but their potency is affected by peptide processing (By similarity).
    • Subcellular location

    • Secreted. Cytoplasmic vesicle › secretory vesicle (By similarity). Note
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Rapid evolution and diversification of mammalian alpha-defensins as revealed by comparative analysis of rodent and primate genes.
    • Reference

    • Physiol Genomics. 2004 Dec 15;20(1):1-11.
    • Author

    • Patil A, Hughes AL, Zhang G.