General Information

    • DRAMP ID

    • DRAMP02722

    • Peptide Name

    • Beta-defensin 1 (BD-1; Defensin, beta 1; primates, mammals,animals)

    • Source

    • Pongo pygmaeus (Bornean orangutan)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK

    • Sequence Length

    • 36

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02722 helical wheel diagram
  • 1E4S-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP02722.

Physicochemical Information

    • Formula

    • C167H262N48O50S6

    • Absent Amino Acids

    • EMW

    • Common Amino Acids

    • C

    • Mass

    • 3934.57

    • PI

    • 8.87

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +5

    • Boman Index

    • -47.14

    • Hydrophobicity

    • -0.272

    • Aliphatic Index

    • 46.11

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4845

    • Absorbance 280nm

    • 138.43

    • Polar Residues

    • 19

DRAMP02722

DRAMP02722 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity (By similarity).

    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35.

Literature Information

  • ·Literature 1

    • Title

    • Beta-defensin 1 gene variability among non-human primates.

    • Reference

    • Immunogenetics. 2002 Feb;53(10-11):907-913.

    • Author

    • Del Pero M, Boniotto M, Zuccon D, Cervella P, Spanò A, Amoroso A, Crovella S.
  • ·Literature 2

    • Title

    • Evolution and sequence variation of human beta-defensin genes.

    • Reference

    • Submitted (NOV-2006) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Hollox E.J, Armour J.A.L.