• DRAMP ID

    • DRAMP02757
    • Peptide Name

    • Ponericin G5 (ants, insects, animals)
    • Source

    • Pachycondyla goeldii (Ponerine ant)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GLKDWVKIAGGWLKKKGPGILKAAMAAATQ
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • [Swiss_Prot Entry P82418]has antibacterial activity
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C144H239N39O35S
    • Absent Amino Acids

    • CEFHNRSY
    • Common Amino Acids

    • AK
    • Mass

    • 3108.78
    • PI

    • 10.3
    • Basic Residues

    • 6
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +5
    • Boman Index

    • 1.08
    • Hydrophobicity

    • 0.027
    • Aliphatic Index

    • 94.67
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 11000
    • Absorbance 280nm

    • 379.31
    • Polar Residues

    • 6

DRAMP02757

DRAMP02757 chydropathy plot
    • Function

    • Has antibacterial activity.
    • Tissue specificity

    • Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Ponericins, new antibacterial and insecticidal peptides from the venom of the ant Pachycondyla goeldii.
    • Reference

    • J. Biol. Chem. 2001; 276: 17823-17829.
    • Author

    • Orivel J, Redeker V, Le Caer JP, Krier F, Revol-Junelles AM, Longeon A, Chafotte A, Dejean A, Rossier J.