• • DRAMP ID

  • DRAMP02774

• • Peptide Name

  • Antimicrobial peptide Alo-1 (Alo-1; knottin-type peptide; Insects, animals)

• • Source

  • Acrocinus longimanus (Giant harlequin beetle)

• • Family

  • Belongs to the AMP family

• • Gene

  • Not found

• • Sequence

  • CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR

• • Sequence Length

  • 34

• • UniProt Entry

  • P83651

• • Protein Existence

  • Protein level

• • SMILES

  • CC[C@@H](C)[C@@H]1NC(=O)[C@@H](N)CSSC[C@@H]2NC(=O)[C@@H]3CSSC[C@@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)O)NC(=O)[C@H](Cc4ccc(O)cc4)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](Cc4c[nH]c5ccccc45)NC(=O)CNC(=O)[C@@H]4CCCN4C(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](Cc4c[nH]cn4)NC(=O)[C@H](CSSC[C@H](NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC1=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(=O)O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N3)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CO)NC2=O

• • Biological Activity

  • Antimicrobial, Antifungal

• • Target Organism

  • • Fungi:

      Target Organism	Activity
      Candida glabrata patient 1	MIC>64 µg/mL
      C. albicans IHEM 8060	MIC=64 µg/mL

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bonds between Cys1 and Cys18; Cys8 and Cys22; Cys17 and Cys33.

• • Stereochemistry

  • L

• • Structure

  • Bridge

• • Structure Description

  • Not found

• • PDB ID

• Predicted Structure

• There is no predicted structure for DRAMP02774.

DRAMP02774

• • Function

  • Has antifungal activity against C. glabrata.

• • Domain

  • The presence of a disulfide through disulfide knot' structurally defines this protein as a knottin.

• • PTM

  • Contains three disulfide bonds 1-18; 8-22; 17-33.

• ·Literature 1

• • Title

  • Solution structure of Alo-3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus.

• • Pubmed ID

  • 14661954

• • Reference

  • Biochemistry. 2003 Dec 16;42(49):14434-14442.

• • Author

  • Barbault F, Landon C, Guenneugues M, Meyer JP, Schott V, Dimarcq JL, Vovelle F.