General Information

    • DRAMP ID

    • DRAMP02800

    • Peptide Name

    • Antimicrobial peptide eNAP-2 (houses, mammals, animals)

    • Source

    • Equus caballus (Horse)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • EVERKHPLGGSRPGRCPTVPPGTFGHCACLCTGDASEPKGQKCCSN

    • Sequence Length

    • 46

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Streptococcus zooepidemicus, Escherichia coli, Pseudomonas aeruginosa.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02800 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02800.

Physicochemical Information

    • Formula

    • C196H316N64O63S6

    • Absent Amino Acids

    • IMWY

    • Common Amino Acids

    • G

    • Mass

    • 4769.42

    • PI

    • 8.36

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +4

    • Boman Index

    • -91.19

    • Hydrophobicity

    • -0.698

    • Aliphatic Index

    • 33.91

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 8.33

    • Polar Residues

    • 20

DRAMP02800

DRAMP02800 chydropathy plot

Comments Information

    • Function

    • Selectively inactivates microbial serine proteases (subtilisin A and proteinase K) without inhibiting mammalian serine proteases (human neutrophil elastase, human cathepsin G and bovine pancreatic trypsin).

Literature Information

  • ·Literature 1

    • Title

    • eNAP-2, a novel cysteine-rich bactericidal peptide from equine leukocytes.

    • Reference

    • Infect Immun. 1992 Dec;60(12):5042-5047.

    • Author

    • Couto MA, Harwig SS, Cullor JS, Hughes JP, Lehrer RI.
  • ·Literature 2

    • Title

    • Selective inhibition of microbial serine proteases by eNAP-2, an antimicrobial peptide from equine neutrophils.

    • Reference

    • Infect Immun. 1993 Jul;61(7):2991-2994.

    • Author

    • Couto MA, Harwig SS, Lehrer RI.