General Information

    • DRAMP ID

    • DRAMP02832

    • Peptide Name

    • Reactive oxygen species modulator 1 (ROS modulator 1; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the MGR2 family

    • Gene

    • ROMO1

    • Sequence

    • MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

    • Sequence Length

    • 79

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus;
      • Gram-negative bacteria: Pseudomonas aeruginosa, Mycobacterium tuberculosis.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02832 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02832.

Physicochemical Information

    • Formula

    • C353H567N99O96S14

    • Absent Amino Acids

    • HNW

    • Common Amino Acids

    • G

    • Mass

    • 8182.83

    • PI

    • 9.58

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 24

    • Net Charge

    • +5

    • Boman Index

    • -13.89

    • Hydrophobicity

    • 0.51

    • Aliphatic Index

    • 60.51

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1740

    • Absorbance 280nm

    • 22.31

    • Polar Residues

    • 30

DRAMP02832

DRAMP02832 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity against a variety of bacteria. Acts by inducing bacterial membrane breakage (By similarity).

    • Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.

Literature Information

  • ·Literature 1

    • Title

    • NIH - Mammalian Gene Collection (MGC) project

    • Reference

    • Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases

    • Author

    • Unknown