General Information

    • DRAMP ID

    • DRAMP02860

    • Peptide Name

    • Bovine Beta-defensin 3 (bBD-3; BNBD-3; BNDB-3; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB3

    • Sequence

    • EGVRNHVTCRINRGFCVPIRCPGRTRQIGTCFGPRIKCCRSW

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus 502A (MIC=10-300 µg/ml);
      • Gram-negative bacterium: Escherichia coli ML35 (MIC=10-300 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02860 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02860.

Physicochemical Information

    • Formula

    • C204H335N73O52S6

    • Absent Amino Acids

    • ADLMY

    • Common Amino Acids

    • R

    • Mass

    • 4834.72

    • PI

    • 10.63

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +9

    • Boman Index

    • -113.84

    • Hydrophobicity

    • -0.393

    • Aliphatic Index

    • 57.86

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 143.29

    • Polar Residues

    • 17

DRAMP02860

DRAMP02860 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity. Active against E. coli ML35 and S. aureus 502A.

    • Tissue specificity

    • Neutrophilic granules.

    • PTM

    • Contains three disulfide bonds 9-38; 16-31; 21-39. (By similarity)

Literature Information

  • ·Literature 1

    • Title

    • Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.

    • Reference

    • J Biol Chem. 1993 Mar 25;268(9):6641-6648.

    • Author

    • Selsted ME, Tang YQ, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.
  • ·Literature 2

    • Title

    • Enteric beta-defensin: molecular cloning and characterization of a gene with inducible intestinal epithelial cell expression associated with Cryptosporidium parvum infection.

    • Reference

    • Infect Immun. 1998 Mar;66(3):1045-1056.

    • Author

    • Tarver AP, Clark DP, Diamond G, Russell JP, Erdjument-Bromage H, Tempst P, Cohen KS, Jones DE, Sweeney RW, Wines M, Hwang S, Bevins CL.