• DRAMP ID

    • DRAMP02861
    • Peptide Name

    • Bovine Beta-defensin 4 (bBD-4; BNBD-4; BNDB-4; mammals, animals)
    • Source

    • Bos taurus (Bovine)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB4
    • Sequence

    • QRVRNPQSCRWNMGVCIPFLCRVGMRQIGTCFGPRVPCCRR
    • Sequence Length

    • 41
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacterium:
        Target OrganismActivity
        Staphylococcus aureus 520A (MIC=10-300 µg/ml);-
      • Gram-negative bacterium:
        Target OrganismActivity
        Escherichia coli ML35MIC=10-300 µg/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02861 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP02861.
    • Formula

    • C201H331N71O49S8
    • Absent Amino Acids

    • ADEHKY
    • Common Amino Acids

    • R
    • Mass

    • 4782.77
    • PI

    • 11.17
    • Basic Residues

    • 8
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +8
    • Boman Index

    • -99.88
    • Hydrophobicity

    • -0.242
    • Aliphatic Index

    • 56.83
    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 146.88
    • Polar Residues

    • 14

DRAMP02861

DRAMP02861 chydropathy plot
    • Function

    • Has bactericidal activity. Active against E. coli ML35 and S. aureus 502A.
    • Tissue specificity

    • Neutrophilic granules.
    • PTM

    • Contains three disulfide bonds 9-38; 16-31; 21-39. (By similarity)
  • ·Literature 1
    • Title

    • Molecular cloning and expression of an antimicrobial beta-defensin from bovine neutrophils. Characterization of BNBD-4 cDNA and genomic sequences and localization of the peptide to large granules of mature neutrophils.
    • Reference

    • Submitted (SEP-1995) to the EMBL/GenBank/DDBJ databases.
    • Author

    • Yount N.Y, Yuan J, Diamond G, Tarver A, McGuire P.A, McCullough C, Cullor J.S, Bevins C.L, Selsted M.E.
  • ·Literature 2
    • Title

    • Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
    • Reference

    • J Biol Chem. 1993 Mar 25;268(9):6641-6648.
    • Author

    • Selsted ME, Tang YQ, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.