General Information

    • DRAMP ID

    • DRAMP02862

    • Peptide Name

    • Bovine Beta-defensin 5 (bBD-5; BNBD-5; BNDB-5; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB5

    • Sequence

    • QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW

    • Sequence Length

    • 42

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli ML35 (MIC=10-300 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02862 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02862.

Physicochemical Information

    • Formula

    • C203H326N68O52S8

    • Absent Amino Acids

    • ADEHKLY

    • Common Amino Acids

    • CR

    • Mass

    • 4807.73

    • PI

    • 9.69

    • Basic Residues

    • 6

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +6

    • Boman Index

    • -80.73

    • Hydrophobicity

    • -0.233

    • Aliphatic Index

    • 55.48

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11375

    • Absorbance 280nm

    • 277.44

    • Polar Residues

    • 16

DRAMP02862

DRAMP02862 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity. Active against E. coli ML35 but not against S. aureus 502A.

    • Tissue specificity

    • Neutrophilic granules. Alveolar macrophages.

    • PTM

    • Contains three disulfide bonds 9-38; 16-31; 21-39. (By similarity)

Literature Information

  • ·Literature 1

    • Title

    • Purification, primary structures, and antibacterial activities of beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.

    • Reference

    • J Biol Chem. 1993 Mar 25;268(9):6641-6648.

    • Author

    • Selsted ME, Tang YQ, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.