• DRAMP ID

    • DRAMP02870
    • Peptide Name

    • Bovine Beta-defensin 13 (bBD-13; BNBD-13; BNDB-13; mammals, animals)
    • Source

    • Bos taurus (Bovine)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • DEFB13
    • Sequence

    • SGISGPLSCGRNGGVCIPIRCPVPMRQIGTCFGRPVKCCRSW
    • Sequence Length

    • 42
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus (MIC=10-300 µg/ml);
      • Gram-negative bacterium: Escherichia coli (MIC=10-300 µg/ml).
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP02870 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP02870.
    • Formula

    • C188H311N61O50S7
    • Absent Amino Acids

    • ADEHY
    • Common Amino Acids

    • G
    • Mass

    • 4450.34
    • PI

    • 9.56
    • Basic Residues

    • 6
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +6
    • Boman Index

    • -49.86
    • Hydrophobicity

    • 0.121
    • Aliphatic Index

    • 67.14
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 143.29
    • Polar Residues

    • 19

DRAMP02870

DRAMP02870 chydropathy plot
    • Function

    • Has bactericidal activity. Active against E. coli ML35 and S. aureus 502A.
    • Tissue specificity

    • Neutrophilic granules.
    • PTM

    • Contains three disulfide bonds 9-38; 16-31; 21-39. (By similarity)
  • ·Literature 1
    • Title

    • Purification, primary structures, and antibacterial activities of Beta-defensins, a new family of antimicrobial peptides from bovine neutrophils.
    • Reference

    • J Biol Chem. 1993 Mar 25;268(9):6641-6648.
    • Author

    • Selsted ME, Tang YQ, Morris WL, McGuire PA, Novotny MJ, Smith W, Henschen AH, Cullor JS.