General Information

    • DRAMP ID

    • DRAMP02871

    • Peptide Name

    • Beta-defensin 119 (Defensin, beta 119; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • DEFB119

    • Sequence

    • RRHMLRCMGDLGICRPACRQSEEPYLYCRNYQPCCLPFYVRIDISGKEGKNDWSRENRWPKVS

    • Sequence Length

    • 63

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: Escherichia coli, Salmonella typhimurium;
      • Gram-positive bacteria: Staphylococcus aureus and Listeria monocytogenes.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02871 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02871.

Physicochemical Information

    • Formula

    • C327H510N102O91S8

    • Absent Amino Acids

    • T

    • Common Amino Acids

    • R

    • Mass

    • 7582.76

    • PI

    • 9.08

    • Basic Residues

    • 13

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +6

    • Boman Index

    • -186.04

    • Hydrophobicity

    • -0.9

    • Aliphatic Index

    • 54.13

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 17335

    • Absorbance 280nm

    • 279.6

    • Polar Residues

    • 21

DRAMP02871

DRAMP02871 chydropathy plot

Comments Information

    • Function Has antibacterial activity (Potential).

    • PTM

    • Contains three disulfide bonds (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Novel bovine AMPs exhibit constitutive tissue-specific gene expression and significant in vitro antimicrobial efficacy against Escherichia coli, Salmonella typhimurium, Stapylococcus aureus and Listeria monocytogenes.

    • Reference

    • Submitted (JUL-2007) to the EMBL/GenBank/DDBJ databases

    • Author

    • Cormican P, Meade K.G, Lloyd A.T, Cahalane S, Narciandi F, O'Farrelly C.