• DRAMP ID

    • DRAMP02878
    • Peptide Name

    • Tracheal antimicrobial peptide (TAP; mammals, animals)
    • Source

    • Bos taurus (Bovine)
    • Family

    • Belongs to the beta-defensin family (LAP/TAP subfamily)
    • Gene

    • Not found
    • Sequence

    • NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK
    • Sequence Length

    • 38
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli D31MIC=12-25 µg/ml
        Klebsiella pneumoniae 13883MIC=12-25 µg/ml
        Pseudomonas aeruginosa 27853MIC=25-50 µg/ml
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus 25923MIC=25-50 µg/ml
      • Fungi:
        Target OrganismActivity
        Candida ablicansMIC=6-12 µg/ml
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C169H302N58O45S7
    • Absent Amino Acids

    • DEFHLWY
    • Common Amino Acids

    • C
    • Mass

    • 4091.04
    • PI

    • 10
    • Basic Residues

    • 9
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 9
    • Net Charge

    • +9
    • Boman Index

    • -65.06
    • Hydrophobicity

    • -0.092
    • Aliphatic Index

    • 71.58
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 375
    • Absorbance 280nm

    • 10.14
    • Polar Residues

    • 15

DRAMP02878

DRAMP02878 chydropathy plot
    • Function

    • Has antibacterial activity in vitro. In addition, the peptide is active against Candida albicans, indicating a broad spectrum of activity.
    • Tissue specificity

    • Tracheal epithelium.
    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35. (By similarity)
  • ·Literature 1
    • Title

    • Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA.
    • Reference

    • Proc Natl Acad Sci U S A. 1991 May 1;88(9):3952-3956.
    • Author

    • Diamond G, Zasloff M, Eck H, Brasseur M, Maloy WL, Bevins CL.
  • ·Literature 2
    • Title

    • Airway epithelial cells are the site of expression of a mammalian antimicrobial peptide gene.
    • Reference

    • Proc Natl Acad Sci U S A. 1993 May 15;90(10):4596-4600.
    • Author

    • Diamond G, Jones DE, Bevins CL.