General Information

    • DRAMP ID

    • DRAMP02878

    • Peptide Name

    • Tracheal antimicrobial peptide (TAP; mammals, animals)

    • Source

    • Bos taurus (Bovine)

    • Family

    • Belongs to the beta-defensin family (LAP/TAP subfamily)

    • Gene

    • Not found

    • Sequence

    • NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Escherichia coli D31 (MIC=12-25 µg/ml), Klebsiella pneumoniae 13883 (MIC=12-25 µg/ml), Pseudomonas aeruginosa 27853 (MIC=25-50 µg/ml).
      • Gram-positive bacteria: Staphylococcus aureus 25923 (MIC=25-50 µg/ml).
      • Fungi: Candida ablicans (MIC=6-12 µg/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP02878 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP02878.

Physicochemical Information

    • Formula

    • C169H302N58O45S7

    • Absent Amino Acids

    • DEFHLWY

    • Common Amino Acids

    • C

    • Mass

    • 4091.04

    • PI

    • 10

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +9

    • Boman Index

    • -65.06

    • Hydrophobicity

    • -0.092

    • Aliphatic Index

    • 71.58

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 375

    • Absorbance 280nm

    • 10.14

    • Polar Residues

    • 15

DRAMP02878

DRAMP02878 chydropathy plot

Comments Information

    • Function

    • Has antibacterial activity in vitro. In addition, the peptide is active against Candida albicans, indicating a broad spectrum of activity.

    • Tissue specificity

    • Tracheal epithelium.

    • PTM

    • Contains three disulfide bonds 5-34; 12-27; 17-35. (By similarity)

Literature Information

  • ·Literature 1

    • Title

    • Tracheal antimicrobial peptide, a cysteine-rich peptide from mammalian tracheal mucosa: peptide isolation and cloning of a cDNA.

    • Reference

    • Proc Natl Acad Sci U S A. 1991 May 1;88(9):3952-3956.

    • Author

    • Diamond G, Zasloff M, Eck H, Brasseur M, Maloy WL, Bevins CL.
  • ·Literature 2

    • Title

    • Airway epithelial cells are the site of expression of a mammalian antimicrobial peptide gene.

    • Reference

    • Proc Natl Acad Sci U S A. 1993 May 15;90(10):4596-4600.

    • Author

    • Diamond G, Jones DE, Bevins CL.