General Information

    • DRAMP ID

    • DRAMP03118

    • Peptide Name

    • Cecropin-C (AgCecC; Insects, animals)

    • Source

    • Anopheles gambiae (African malaria mosquito)

    • Family

    • Belongs to the cecropin family

    • Gene

    • CecC

    • Sequence

    • RRFKKFLKKVEGAGRRVANAAQKGLPLAAGVKGLV

    • Sequence Length

    • 35

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03118 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03118.

Physicochemical Information

    • Formula

    • C169H293N55O40

    • Absent Amino Acids

    • CDHIMSTWY

    • Common Amino Acids

    • AK

    • Mass

    • 3735.53

    • PI

    • 12.02

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +9

    • Boman Index

    • -54.61

    • Hydrophobicity

    • -0.203

    • Aliphatic Index

    • 94.86

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 6

DRAMP03118

DRAMP03118 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria (By similarity).

Literature Information

  • ·Literature 1

    • Title

    • Genomic organization and regulation of three cecropin genes in Anopheles gambiae.

    • Reference

    • Insect Mol Biol. 2002 Dec;11(6):517-525.

    • Author

    • Zheng XL, Zheng AL.