• DRAMP ID

    • DRAMP03120
    • Peptide Name

    • Def-BBB (hybrid defensins; Insects, animals)
    • Source

    • Anopheles gambiae (African malaria mosquito)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • ATCDLASFSSQWVTPNDSLCAAHCLVKGYRGGYCKNKICHCRDKF
    • Sequence Length

    • 45
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus strain 21IC90=10 µg/mL
        Staphylococcus aureus strain 4IC90>80 µg/mL
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Global fold has a N-terminal loop L1, followed by a helix and a two-stranded antiparallel β-sheet forming the CSab motif.
    • PDB ID

    • 2E3E resolved by NMR.
    • Predicted Structure

    • Formula

    • C215H331N63O63S6
    • Absent Amino Acids

    • EM
    • Common Amino Acids

    • C
    • Mass

    • 4998.74
    • PI

    • 8.64
    • Basic Residues

    • 8
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +5
    • Boman Index

    • -71.57
    • Hydrophobicity

    • -0.24
    • Aliphatic Index

    • 56.44
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8855
    • Absorbance 280nm

    • 201.25
    • Polar Residues

    • 19

DRAMP03120

    • Function

    • Responsible for the anti Gram-positive activity of immune hemolymph and proves to be efficient against sensitive
    • strains as against resistant and multi-resistant strains.

  • ·Literature 1
    • Title

    • Rational design of peptides active against the gram positive bacteria Staphylococcus aureus.
    • Reference

    • Proteins. 2008 Jul;72(1):229-239.
    • Author

    • Landon C, Barbault F, Legrain M, Guenneugues M, Vovelle F.