General Information

    • DRAMP ID

    • DRAMP03120

    • Peptide Name

    • Def-BBB (hybrid defensins; Insects, animals)

    • Source

    • Anopheles gambiae (African malaria mosquito)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • ATCDLASFSSQWVTPNDSLCAAHCLVKGYRGGYCKNKICHCRDKF

    • Sequence Length

    • 45

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

      • Gram-positive bacteria: Staphylococcus aureus strain 21 (IC90=10 µg/mL), Staphylococcus aureus strain 4 (IC90>80 µg/mL).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Global fold has a N-terminal loop L1, followed by a helix and a two-stranded antiparallel β-sheet forming the CSab motif.

    • Helical Wheel Diagram

    • DRAMP03120 helical wheel diagram

    • PDB ID

    • 2E3E resolved by NMR.

    • Predicted Structure

    • There is no predicted structure for DRAMP03120.

Physicochemical Information

    • Formula

    • C215H331N63O63S6

    • Absent Amino Acids

    • EM

    • Common Amino Acids

    • C

    • Mass

    • 4998.74

    • PI

    • 8.64

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 13

    • Net Charge

    • +5

    • Boman Index

    • -71.57

    • Hydrophobicity

    • -0.24

    • Aliphatic Index

    • 56.44

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8855

    • Absorbance 280nm

    • 201.25

    • Polar Residues

    • 19

DRAMP03120

DRAMP03120 chydropathy plot

Comments Information

    • Function

    • Responsible for the anti Gram-positive activity of immune hemolymph and proves to be efficient against sensitive

    • strains as against resistant and multi-resistant strains.

Literature Information

  • ·Literature 1

    • Title

    • Rational design of peptides active against the gram positive bacteria Staphylococcus aureus.

    • Reference

    • Proteins. 2008 Jul;72(1):229-239.

    • Author

    • Landon C, Barbault F, Legrain M, Guenneugues M, Vovelle F.