• DRAMP ID

    • DRAMP03175
    • Peptide Name

    • Perinerin
    • Source

    • Nereis aibuhitensis (Clamworm) (Perinereis aibuhitensis)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY
    • Sequence Length

    • 51
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal
    • Target Organism

      • Gram-negative bacteria: Pseudomonas aeruginosa, Escherichia coli K-12, Proteus vulgaris;
      • Gram-positive bacteria: Bacillus megaterium, Aerococcus viridans, Staphylococcus aureus, Micrococcus luteus.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03175 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03175.
    • Formula

    • C257H421N87O68S5
    • Absent Amino Acids

    • ?
    • Common Amino Acids

    • R
    • Mass

    • 5978.01
    • PI

    • 10.66
    • Basic Residues

    • 15
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 14
    • Net Charge

    • +12
    • Boman Index

    • -161.63
    • Hydrophobicity

    • -0.8
    • Aliphatic Index

    • 49.8
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 7240
    • Absorbance 280nm

    • 144.8
    • Polar Residues

    • 16

DRAMP03175

DRAMP03175 chydropathy plot
    • Function

    • Antibacterial activity against both Gram-negative and Gram-positive bacteria.
  • ·Literature 1
    • Title

    • Perinerin, a novel antimicrobial peptide purified from the clamworm Perinereis aibuhitensis grube and its partial characterization.
    • Reference

    • J Biochem. 2004 Mar;135(3):297-304.
    • Author

    • Pan W, Liu X, Ge F, Han J, Zheng T.