General Information

    • DRAMP ID

    • DRAMP03175

    • Peptide Name

    • Perinerin

    • Source

    • Nereis aibuhitensis (Clamworm) (Perinereis aibuhitensis)

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • FNKLKQGSSKRTCAKCFRKIMPSVHELDERRRGANRWAAGFRKCVSSICRY

    • Sequence Length

    • 51

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacteria: Pseudomonas aeruginosa, Escherichia coli K-12, Proteus vulgaris;
      • Gram-positive bacteria: Bacillus megaterium, Aerococcus viridans, Staphylococcus aureus, Micrococcus luteus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03175 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03175.

Physicochemical Information

    • Formula

    • C257H421N87O68S5

    • Absent Amino Acids

    • ?

    • Common Amino Acids

    • R

    • Mass

    • 5978.01

    • PI

    • 10.66

    • Basic Residues

    • 15

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +12

    • Boman Index

    • -161.63

    • Hydrophobicity

    • -0.8

    • Aliphatic Index

    • 49.8

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 144.8

    • Polar Residues

    • 16

DRAMP03175

DRAMP03175 chydropathy plot

Comments Information

    • Function

    • Antibacterial activity against both Gram-negative and Gram-positive bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Perinerin, a novel antimicrobial peptide purified from the clamworm Perinereis aibuhitensis grube and its partial characterization.

    • Reference

    • J Biochem. 2004 Mar;135(3):297-304.

    • Author

    • Pan W, Liu X, Ge F, Han J, Zheng T.