• DRAMP ID

    • DRAMP03185
    • Peptide Name

    • Spheniscin-1 (Sphe-1; penguin avian beta-defensin 103a; birds ,animals)
    • Source

    • Aptenodytes patagonicus (King penguin)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Not found
    • Sequence

    • SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW
    • Sequence Length

    • 38
    • Protein Existence

    • Protein level
    • SMILES

    • CC[C@@H](C)[C@@H]1NC(=O)[C@@H]2CCCN2C(=O)[C@H]([C@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@@H]2CCCN2C(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]2CSSC[C@@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](Cc3c[nH]c4ccccc34)C(=O)O)C(C)C)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc4ccccc4)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](Cc4ccccc4)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC1=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N3)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N2
    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys33; Cys12 and Cys27; Cys17 and Cys34.
    • Stereochemistry

    • L
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C194H309N69O43S6
    • Absent Amino Acids

    • DEKMNTY
    • Common Amino Acids

    • R
    • Mass

    • 4488.38
    • PI

    • 11.46
    • Basic Residues

    • 10
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +10
    • Boman Index

    • -99.42
    • Hydrophobicity

    • -0.061
    • Aliphatic Index

    • 58.95
    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 158.78
    • Polar Residues

    • 13

DRAMP03185

    • Function

    • Has antifungal activity and antibacterial activity against Gram-positive and Gram-negative bacteria. Involved in the process of food preservation in the stomach during the incubation fast. May also be present during infection.
    • PTM

    • Contains three disulfide bond
    • Tissue specificity

    • Secreted into the stomach cavity.
  • ·Literature 1
    • Title

    • Spheniscins, avian beta-defensins in preserved stomach contents of the king penguin, Aptenodytes patagonicus.
    • Reference

    • J Biol Chem. 2003 Dec 19;278(51):51053-8.
    • Author

    • Thouzeau C, Le Maho Y, Froget G, Sabatier L, Le Bohec C, Hoffmann JA, Bulet P.