• • DRAMP ID

  • DRAMP03185

• • Peptide Name

  • Spheniscin-1 (Sphe-1; penguin avian beta-defensin 103a; birds ,animals)

• • Source

  • Aptenodytes patagonicus (King penguin)

• • Family

  • Belongs to the beta-defensin family

• • Gene

  • Not found

• • Sequence

  • SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW

• • Sequence Length

  • 38

• • UniProt Entry

  • P83429

• • Protein Existence

  • Protein level

• • SMILES

  • CC[C@@H](C)[C@@H]1NC(=O)[C@@H]2CCCN2C(=O)[C@H]([C@H](C)CC)NC(=O)[C@H](CO)NC(=O)[C@@H]2CCCN2C(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@@H]2CSSC[C@@H](C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@H](C(=O)N[C@@H](Cc3c[nH]c4ccccc34)C(=O)O)C(C)C)NC(=O)[C@@H]3CSSC[C@H](NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](Cc4ccccc4)NC(=O)[C@@H](N)CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](Cc4ccccc4)C(=O)N[C@@H](CSSC[C@H](NC(=O)[C@H](CCCNC(=N)N)NC(=O)CNC1=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N3)C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N2

• • Biological Activity

  • Antimicrobial, Antibacterial, Antifungal

• • Target Organism

  • No MICs found in DRAMP database

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • No cytotoxicity information found in the reference(s) presented

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Cyclic

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Disulfide bonds between Cys5 and Cys33; Cys12 and Cys27; Cys17 and Cys34.

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • PDB ID

• Predicted Structure

• There is no predicted structure for DRAMP03185.

DRAMP03185

• • Function

  • Has antifungal activity and antibacterial activity against Gram-positive and Gram-negative bacteria. Involved in the process of food preservation in the stomach during the incubation fast. May also be present during infection.

• • PTM

  • Contains three disulfide bond

• • Tissue specificity

  • Secreted into the stomach cavity.

• ·Literature 1

• • Title

  • Spheniscins, avian beta-defensins in preserved stomach contents of the king penguin, Aptenodytes patagonicus.

• • Pubmed ID

  • 14525994

• • Reference

  • J Biol Chem. 2003 Dec 19;278(51):51053-8.

• • Author

  • Thouzeau C, Le Maho Y, Froget G, Sabatier L, Le Bohec C, Hoffmann JA, Bulet P.