General Information

    • DRAMP ID

    • DRAMP03185

    • Peptide Name

    • Spheniscin-1 (Sphe-1; penguin avian beta-defensin 103a; birds ,animals)

    • Source

    • Aptenodytes patagonicus (King penguin)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Not found

    • Sequence

    • SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys5 and Cys33; Cys12 and Cys27; Cys17 and Cys34.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03185 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03185.

Physicochemical Information

    • Formula

    • C194H309N69O43S6

    • Absent Amino Acids

    • DEKMNTY

    • Common Amino Acids

    • R

    • Mass

    • 4488.38

    • PI

    • 11.46

    • Basic Residues

    • 10

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 12

    • Net Charge

    • +10

    • Boman Index

    • -99.42

    • Hydrophobicity

    • -0.061

    • Aliphatic Index

    • 58.95

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5875

    • Absorbance 280nm

    • 158.78

    • Polar Residues

    • 13

DRAMP03185

DRAMP03185 chydropathy plot

Comments Information

    • Function

    • Has antifungal activity and antibacterial activity against Gram-positive and Gram-negative bacteria. Involved in the process of food preservation in the stomach during the incubation fast. May also be present during infection.

    • PTM

    • Contains three disulfide bond

    • Tissue specificity

    • Secreted into the stomach cavity.

Literature Information

  • ·Literature 1

    • Title

    • Spheniscins, avian beta-defensins in preserved stomach contents of the king penguin, Aptenodytes patagonicus.

    • Reference

    • J Biol Chem. 2003 Dec 19;278(51):51053-8.

    • Author

    • Thouzeau C, Le Maho Y, Froget G, Sabatier L, Le Bohec C, Hoffmann JA, Bulet P.