General Information

    • DRAMP ID

    • DRAMP03235

    • Peptide Name

    • M-zodatoxin-Lt6b (M-ZDTX-Lt6b; Latarcin 6b, Ltc-6b; spiders, Arthropods, animals)

    • Source

    • Lachesana tarabaevi (Spider)

    • Family

    • Belongs to the latarcin family

    • Gene

    • Not found

    • Sequence

    • QAFKTFTPDWNKIRNDAKRMQDNLEQMKKRFNLNL

    • Sequence Length

    • 35

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antibacterial, Antimicrobial, Antifungal, Antiviral

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03235 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03235.

Physicochemical Information

    • Formula

    • C191H304N58O54S2

    • Absent Amino Acids

    • CGHSVY

    • Common Amino Acids

    • KN

    • Mass

    • 4340.99

    • PI

    • 10.16

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +4

    • Boman Index

    • -121.17

    • Hydrophobicity

    • -1.349

    • Aliphatic Index

    • 50.29

    • Half Life

      • Mammalian:0.8 hour
      • Yeast:10 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 161.76

    • Polar Residues

    • 7

DRAMP03235

DRAMP03235 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Latarcins, antimicrobial and cytolytic peptides from the venom of the spider Lachesana tarabaevi (Zodariidae) that exemplify biomolecular diversity.

    • Reference

    • J Biol Chem. 2006 Jul 28;281(30):20983-20992.

    • Author

    • Kozlov SA, Vassilevski AA, Feofanov AV, Surovoy AY, Karpunin DV, Grishin EV.