• DRAMP ID

    • DRAMP03296
    • Peptide Name

    • Defensin-B5 (DefB5; OaDefB5; mammals, animals)
    • Source

    • Ornithorhynchus anatinus (Duckbill platypus)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Not found
    • Sequence

    • KKCRERGGQCHSGVCSWNEKFIGFCSFARPCC
    • Sequence Length

    • 32
    • Protein Existence

    • Transcript level
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03296 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03296.
    • Formula

    • C153H235N49O42S6
    • Absent Amino Acids

    • DLMTY
    • Common Amino Acids

    • C
    • Mass

    • 3625.21
    • PI

    • 8.94
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +5
    • Boman Index

    • -68.59
    • Hydrophobicity

    • -0.469
    • Aliphatic Index

    • 24.38
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 189.52
    • Polar Residues

    • 14

DRAMP03296

DRAMP03296 chydropathy plot
    • Function

    • Has antimicrobial activity (By similarity).
    • Tissue specificity

    • Highly expressed in kidney, and expressed at lower levels in testis.
    • PTM

    • Contains three disulfide bonds (By similarity).
  • ·Literature 1
    • Title

    • Defensins and the convergent evolution of platypus and reptile venom genes.
    • Reference

    • Genome Res. 2008 Jun;18(6):986-994.
    • Author

    • Whittington CM, Papenfuss AT, Bansal P, Torres AM, Wong ES, Deakin JE, Graves T, Alsop A, Schatzkamer K, Kremitzki C, Ponting CP, Temple-Smith P, Warren WC, Kuchel PW, Belov K.
  • ·Literature 2
    • Title

    • Expression patterns of platypus defensin and related venom genes across a range of tissue types reveal the possibility of broader functions for OvDLPs than previously suspected.
    • Reference

    • Toxicon. 2008 Sep 15;52(4):559-565.
    • Author

    • Whittington CM, Papenfuss AT, Kuchel PW, Belov K.