General Information

    • DRAMP ID

    • DRAMP03305

    • Peptide Name

    • Neuromacin (Annelida, animals)

    • Source

    • Hirudo medicinalis (Medicinal leech)

    • Family

    • Belongs to the macin family

    • Gene

    • Not found

    • Sequence

    • DCYEDWSRCTPGTSFLTGILWKDCHSRCKELGHRGGRCVDSPSKHCPGVLKNNKQCHCY

    • Sequence Length

    • 59

    • Protein Existence

    • Homology

Activity Information

    • Biological Activity

    • Antimicrobial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03305 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03305.

Physicochemical Information

    • Formula

    • C284H437N89O85S8

    • Absent Amino Acids

    • AM

    • Common Amino Acids

    • C

    • Mass

    • 6714.62

    • PI

    • 8.49

    • Basic Residues

    • 13

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +7

    • Boman Index

    • -142.18

    • Hydrophobicity

    • -0.824

    • Aliphatic Index

    • 42.88

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 14480

    • Absorbance 280nm

    • 249.66

    • Polar Residues

    • 26

DRAMP03305

DRAMP03305 chydropathy plot

Comments Information

    • Function

    • May have antimicrobial activity.

    • PTM

    • Contains four disulfide bonds By similarity.

Literature Information

  • ·Literature 1

    • Title

    • Microbial challenge promotes the regenerative process of the injured central nervous system of the medicinal leech by inducing the synthesis of antimicrobial peptides in neurons and microglia.

    • Reference

    • J Immunol. 2008 Jul 15;181(2):1083-1095.

    • Author

    • Schikorski D, Cuvillier-Hot V, Leippe M, Boidin-Wichlacz C, Slomianny C, Macagno E, Salzet M, Tasiemski A.