• DRAMP ID

    • DRAMP03305
    • Peptide Name

    • Neuromacin (Annelida, animals)
    • Source

    • Hirudo medicinalis (Medicinal leech)
    • Family

    • Belongs to the macin family
    • Gene

    • Not found
    • Sequence

    • DCYEDWSRCTPGTSFLTGILWKDCHSRCKELGHRGGRCVDSPSKHCPGVLKNNKQCHCY
    • Sequence Length

    • 59
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03305.
    • Formula

    • C284H437N89O85S8
    • Absent Amino Acids

    • AM
    • Common Amino Acids

    • C
    • Mass

    • 6714.62
    • PI

    • 8.49
    • Basic Residues

    • 13
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +7
    • Boman Index

    • -142.18
    • Hydrophobicity

    • -0.824
    • Aliphatic Index

    • 42.88
    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 14480
    • Absorbance 280nm

    • 249.66
    • Polar Residues

    • 26

DRAMP03305

    • Function

    • May have antimicrobial activity.
    • PTM

    • Contains four disulfide bonds By similarity.
  • ·Literature 1
    • Title

    • Microbial challenge promotes the regenerative process of the injured central nervous system of the medicinal leech by inducing the synthesis of antimicrobial peptides in neurons and microglia.
    • Reference

    • J Immunol. 2008 Jul 15;181(2):1083-1095.
    • Author

    • Schikorski D, Cuvillier-Hot V, Leippe M, Boidin-Wichlacz C, Slomianny C, Macagno E, Salzet M, Tasiemski A.