General Information

    • DRAMP ID

    • DRAMP03373

    • Peptide Name

    • Beta-defensin 8 (BD-8, mBD-8; Defensin, beta 8; Rodents, mammals, animals)

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • Defb8

    • Sequence

    • NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK

    • Sequence Length

    • 35

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus;
      • Gram-negative bacteria: Pseudomonas aeruginosa, Escherichia coli, Burkholderia cepacia.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Combine helix and strand structure

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03373 helical wheel diagram

    • PDB ID

    • 1E4R resolved by NMR.
  • 1E4R-> 

    • Predicted Structure

    • There is no predicted structure for DRAMP03373.

Physicochemical Information

    • Formula

    • C161H266N52O45S6

    • Absent Amino Acids

    • ADMW

    • Common Amino Acids

    • C

    • Mass

    • 3842.56

    • PI

    • 9.15

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +6

    • Boman Index

    • -57.21

    • Hydrophobicity

    • -0.211

    • Aliphatic Index

    • 64

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 54.85

    • Polar Residues

    • 17

DRAMP03373

DRAMP03373 chydropathy plot

Comments Information

    • PTM

    • Contains three disulfide bonds 6-33; 13-27; 17-34.

    • Function

    • The antimicrobial activity against S. aureus, E. coli and B.cepacia is reduced in raised concentration of NaCl, but its action against Pseudomonas aeruginosa is independent of NaCl concentration.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and characterization of mBD-7 and mBD-8, two novel mouse beta-defensins.

    • Reference

    • Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.

    • Author

    • Conejo-Garcia JR, Nehls MC, Wattler S, Bals R, Heitland A, Kluever E, Liepke C, Adermann K, Forssmann WG.
  • ·Literature 2

    • Title

    • Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity.

    • Reference

    • Protein Sci. 2001 Dec;10(12):2470-2479.

    • Author

    • Bauer F, Schweimer K, Klüver E, Conejo-Garcia JR, Forssmann WG, Rösch P, Adermann K, Sticht H.