• DRAMP ID

    • DRAMP03373
    • Peptide Name

    • Beta-defensin 8 (BD-8, mBD-8; Defensin, beta 8; Rodents, mammals, animals)
    • Source

    • Mus musculus (Mouse)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb8
    • Sequence

    • NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK
    • Sequence Length

    • 35
    • Protein Existence

    • Protein level
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-positive bacterium: Staphylococcus aureus;
      • Gram-negative bacteria: Pseudomonas aeruginosa, Escherichia coli, Burkholderia cepacia.
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Combine helix and strand structure
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03373 helical wheel diagram
    • PDB ID

    • 1E4R resolved by NMR.
    • Predicted Structure

    • There is no predicted structure for DRAMP03373.
    • Formula

    • C161H266N52O45S6
    • Absent Amino Acids

    • ADMW
    • Common Amino Acids

    • C
    • Mass

    • 3842.56
    • PI

    • 9.15
    • Basic Residues

    • 7
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 7
    • Net Charge

    • +6
    • Boman Index

    • -57.21
    • Hydrophobicity

    • -0.211
    • Aliphatic Index

    • 64
    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1865
    • Absorbance 280nm

    • 54.85
    • Polar Residues

    • 17

DRAMP03373

DRAMP03373 chydropathy plot
    • PTM

    • Contains three disulfide bonds 6-33; 13-27; 17-34.
    • Function

    • The antimicrobial activity against S. aureus, E. coli and B.cepacia is reduced in raised concentration of NaCl, but its action against Pseudomonas aeruginosa is independent of NaCl concentration.
  • ·Literature 1
    • Title

    • Cloning and characterization of mBD-7 and mBD-8, two novel mouse beta-defensins.
    • Reference

    • Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.
    • Author

    • Conejo-Garcia JR, Nehls MC, Wattler S, Bals R, Heitland A, Kluever E, Liepke C, Adermann K, Forssmann WG.
  • ·Literature 2
    • Title

    • Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity.
    • Reference

    • Protein Sci. 2001 Dec;10(12):2470-2479.
    • Author

    • Bauer F, Schweimer K, Klüver E, Conejo-Garcia JR, Forssmann WG, Rösch P, Adermann K, Sticht H.