• DRAMP ID

    • DRAMP03436
    • Peptide Name

    • Beta-defensin 18 (BD-18, RBD-18; Defensin, beta 18; Rodents, mammals, animals)
    • Source

    • Rattus norvegicus (Rat)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb18
    • Sequence

    • APQMKTRDVLERTHKCFLVGGECKSECSSWEYEYVFCYTGPCCVMREYKRVEKFSNTPKYTT
    • Sequence Length

    • 62
    • Protein Existence

    • Homology
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C322H491N85O96S8
    • Absent Amino Acids

    • I
    • Common Amino Acids

    • ECKT
    • Mass

    • 7345.43
    • PI

    • 8.28
    • Basic Residues

    • 11
    • Acidic Residues

    • 8
    • Hydrophobic Residues

    • 12
    • Net Charge

    • +3
    • Boman Index

    • -137.61
    • Hydrophobicity

    • -0.69
    • Aliphatic Index

    • 37.58
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 13325
    • Absorbance 280nm

    • 218.44
    • Polar Residues

    • 25

DRAMP03436

    • Function Has antibacterial activity (By similarity).

  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.