• DRAMP ID

    • DRAMP03447
    • Peptide Name

    • Beta-defensin 37 (Rodents, mammals, animals)
    • Source

    • Rattus norvegicus (Rat)
    • Family

    • Belongs to the beta-defensin family
    • Gene

    • Defb37
    • Sequence

    • MKISCFLLLVLSLSCFQINPFAVLDTRVCIEKRNTCHILQCPLFRDVVGTCFEGIGKCCHKYF
    • Sequence Length

    • 63
    • Protein Existence

    • Predicted
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C325H516N84O83S9
    • Absent Amino Acids

    • W
    • Common Amino Acids

    • CL
    • Mass

    • 7216.73
    • PI

    • 8.49
    • Basic Residues

    • 9
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 25
    • Net Charge

    • +5
    • Boman Index

    • -30.49
    • Hydrophobicity

    • 0.646
    • Aliphatic Index

    • 105.08
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 1990
    • Absorbance 280nm

    • 32.1
    • Polar Residues

    • 20

DRAMP03447

DRAMP03447 chydropathy plot
    • Function Has antibacterial activity (By similarity).

  • ·Literature 1
    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family: presence of syntenic gene clusters and preferential expression in the male reproductive tract.
    • Reference

    • Physiol Genomics. 2005 Sep 21;23(1):5-17.
    • Author

    • Patil AA, Cai Y, Sang Y, Blecha F, Zhang G.