General Information

    • DRAMP ID

    • DRAMP03480

    • Peptide Name

    • Bactericidin B-3 (Cecropin-like peptide B-3; Insects, animals)

    • Source

    • Manduca sexta (Tobacco hornworm)

    • Family

    • Belongs to the cecropin family

    • Gene

    • Not found

    • Sequence

    • WNPFKELERAGQRVRDAIISAGPAVATVGQAAAIARG

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03480 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03480.

Physicochemical Information

    • Formula

    • C169H276N54O49

    • Absent Amino Acids

    • CHMY

    • Common Amino Acids

    • A

    • Mass

    • 3848.38

    • PI

    • 10.67

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +2

    • Boman Index

    • -54.1

    • Hydrophobicity

    • -0.032

    • Aliphatic Index

    • 90

    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5500

    • Absorbance 280nm

    • 152.78

    • Polar Residues

    • 7

DRAMP03480

DRAMP03480 chydropathy plot

Comments Information

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • A family of bacteria-regulated, cecropin D-like peptides from Manduca sexta.

    • Reference

    • J Biol Chem. 1988 Dec 25;263(36):19424-19429.

    • Author

    • Dickinson L, Russell V, Dunn PE.