• DRAMP ID

    • DRAMP03485
    • Peptide Name

    • Bactericidin B-5P (Cecropin-like peptide B-5; Insects, animals)
    • Source

    • Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
    • Family

    • Belongs to the cecropin family
    • Gene

    • Not found
    • Sequence

    • WNPFKELERAGQRVRDAVISAAAVATVGQAAAIARGG
    • Sequence Length

    • 37
    • Protein Existence

    • Homology
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP03485 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP03485.
    • Formula

    • C166H272N54O49
    • Absent Amino Acids

    • CHMY
    • Common Amino Acids

    • A
    • Mass

    • 3808.32
    • PI

    • 10.67
    • Basic Residues

    • 5
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 19
    • Net Charge

    • +2
    • Boman Index

    • -53.17
    • Hydrophobicity

    • 0.051
    • Aliphatic Index

    • 90
    • Half Life

      • Mammalian:2.8 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 152.78
    • Polar Residues

    • 7

DRAMP03485

DRAMP03485 chydropathy plot
    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • A family of bacteria-regulated, cecropin D-like peptides from Manduca sexta.
    • Reference

    • J Biol Chem. 1988 Dec 25;263(36):19424-19429.
    • Author

    • Dickinson L, Russell V, Dunn PE.