• DRAMP ID

    • DRAMP03486
    • Peptide Name

    • Manduca Sexta Moricin (MS moricin; Insects, animals)
    • Source

    • Manduca sexta (Tobacco hornworm)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH
    • Sequence Length

    • 42
    • Protein Existence

    • Protein level
    • SMILES

    • CC[C@@H](C)[C@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CN)[C@H](C)CC)C(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@@H](C)C(=O)NCC(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](CC(=O)N[C@H](C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)C(C)C)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)O)C(C)C)[C@@H](C)O)[C@@H](C)O)[C@H](C)CC)[C@H](C)CC)[C@H](C)CC)C(C)C
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Klebsiella pneumoniaeMIC=6.25 µg/ml
        Salmonella typhimuriumMIC=6.25 µg/ml
        S. typhimurium DT104MIC=6.25 µg/ml
        Escherichia coli O157:H7MIC=6.25 µg/ml
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCC 25 923MIC=6.25 µg/ml
        Methicillin-resistant S. aureus ATCC 43 300MIC=6.25 µg/ml
        Methicillin-resistant S. aureus ATCC BAA-39MIC=12.5 µg/ml
        Listeria monocytogenesMIC=6.25 µg/ml
      • NOTE:
        Target OrganismActivity
        MIC is defined as the lowest peptide concentration that gives no visible growth after overnight incubation in 100% Muller-Hinton broth-
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Linear
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Free
    • Nonterminal Modifications and Unusual Amino Acids

    • Free
    • Stereochemistry

    • L
    • Structure

    • Alpha helix (1 helices; 31 residues)
    • Structure Description

    • The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. (Ref.1)
    • PDB ID

    • 2JR8 resolved by NMR.
    • Predicted Structure

    • Formula

    • C208H355N63O50
    • Absent Amino Acids

    • CEMWY
    • Common Amino Acids

    • K
    • Mass

    • 4538.5
    • PI

    • 11.36
    • Basic Residues

    • 13
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 16
    • Net Charge

    • +12
    • Boman Index

    • -54.97
    • Hydrophobicity

    • -0.298
    • Aliphatic Index

    • 92.86
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 9

DRAMP03486

    • Function

    • Exhibits potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM.
    • Tissue specificity

    • expressed in Manduca sexta fat body.
  • ·Literature 1
    • Title

    • Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.
    • Reference

    • J Pept Sci. 2008 Jul;14(7):855-863.
    • Author

    • Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H.
  • ·Literature 2
    • Title

    • Identification by subtractive suppression hybridization of bacteria-induced genes expressed in Manduca sexta fat body.
    • Reference

    • Insect Biochem Mol Biol. 2003 May;33(5):541-59.
    • Author

    • Zhu Y, Johnson TJ, Myers AA, Kanost MR.