• • DRAMP ID

  • DRAMP03486

• • Peptide Name

  • Manduca Sexta Moricin (MS moricin; Insects, animals)

• • Source

  • Manduca sexta (Tobacco hornworm)

• • Family

  • Not found

• • Gene

  • Not found

• • Sequence

  • GKIPVKAIKQAGKVIGKGLRAINIAGTTHDVVSFFRPKKKKH

• • Sequence Length

  • 42

• • UniProt Entry

  • Q86MA1

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • Gram-negative bacteria: Klebsiella pneumoniae (MIC=6.25 µg/ml), Salmonella typhimurium (MIC=6.25 µg/ml), S. typhimurium DT104 (MIC=6.25 µg/ml), Escherichia coli O157:H7 (MIC=6.25 µg/ml);
    • Gram-positive bacteria: Staphylococcus aureus ATCC 25 923 (MIC=6.25 µg/ml), Methicillin-resistant S. aureus ATCC 43 300 (MIC=6.25 µg/ml), Methicillin-resistant S. aureus ATCC BAA-39 (MIC=12.5 µg/ml), Listeria monocytogenes (MIC=6.25 µg/ml).
    • NOTE: MIC is defined as the lowest peptide concentration that gives no visible growth after overnight incubation in 100% Muller-Hinton broth.

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Alpha helix (1 helices; 31 residues)

• • Structure Description

  • The tertiary structure is composed of an eight-turn alpha-helix spanning almost the entire peptide. Insights of relationships between the structure and function are also presented. (Ref.1)

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 2JR8 resolved by NMR.
• 2JR8-> 

• Predicted Structure

• Please click DRAMP03486_predicted_structure.pdb to download.

DRAMP03486

• • Function

  • Exhibits potent antimicrobial activities against a broad spectrum of Gram-positive and Gram-negative bacteria with a minimum inhibitory concentration of 1.4 microM.

• • Tissue specificity

  • expressed in Manduca sexta fat body.

• ·Literature 1

• • Title

  • Solution structure, antibacterial activity, and expression profile of Manduca sexta moricin.

• • Pubmed ID

  • 18265434

• • Reference

  • J Pept Sci. 2008 Jul;14(7):855-863.

• • Author

  • Dai H, Rayaprolu S, Gong Y, Huang R, Prakash O, Jiang H.

• ·Literature 2

• • Title

  • Identification by subtractive suppression hybridization of bacteria-induced genes expressed in Manduca sexta fat body.

• • Pubmed ID

  • 12706633

• • Reference

  • Insect Biochem Mol Biol. 2003 May;33(5):541-59.

• • Author

  • Zhu Y, Johnson TJ, Myers AA, Kanost MR.