General Information

    • DRAMP ID

    • DRAMP03514

    • Peptide Name

    • G. mellonella moricin-like peptide B (Gm-mlpB; Insects, animals; Predicted)

    • Source

    • Galleria mellonella (Greater wax moth)

    • Family

    • Not found

    • Gene

    • mor

    • Sequence

    • GKIPVKAIKKGGQIIGKALRGINIASTAHDIISQFKPKKKKNH

    • Sequence Length

    • 43

    • Protein Existence

    • Predicted

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=100 µM);
      • Gram-positive bacterium: Micrococcus luteus (MIC=100 µM).
      • Fungi: Fusarium graminearum spores (MIC=10 µM), F;
      • Graminearum mycelia (MIC=280 µM), Fusarium oxysporum spores (MIC=100 µM), F. oxysporum mycelia (MIC=280 µM), Leptosphaeria maculans spores (MIC=100 µM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Linear

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Free

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03514 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C210H364N64O53

    • Absent Amino Acids

    • CEMWY

    • Common Amino Acids

    • K

    • Mass

    • 4633.6

    • PI

    • 10.92

    • Basic Residues

    • 13

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +12

    • Boman Index

    • -58.95

    • Hydrophobicity

    • -0.486

    • Aliphatic Index

    • 97.67

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 10

DRAMP03514

DRAMP03514 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • The discovery and analysis of a diverged family of novel antifungal moricin-like peptides in the wax moth Galleria mellonella.

    • Reference

    • Insect Biochem Mol Biol. 2008;38:201-212.

    • Author

    • Brown SE, Howard A, Kasprzak AB, Gordon KH, East PD.