• • DRAMP ID

  • DRAMP03514

• • Peptide Name

  • G. mellonella moricin-like peptide B (Gm-mlpB; Insects, animals; Predicted)

• • Source

  • Galleria mellonella (Greater wax moth)

• • Family

  • Not found

• • Gene

  • mor

• • Sequence

  • GKIPVKAIKKGGQIIGKALRGINIASTAHDIISQFKPKKKKNH

• • Sequence Length

  • 43

• • UniProt Entry

  • A5JSU6

• • Protein Existence

  • Predicted

• • SMILES

  • CC[C@@H](C)[C@H](NC(=O)C[C@H](NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H]1CCCN1C(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)CN)[C@H](C)CC)C(C)C)[C@H](C)CC)[C@H](C)CC)[C@H](C)CC)[C@H](C)CC)[C@H](C)CC)[C@@H](C)O)C(=O)N[C@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1ccccc1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](Cc1c[nH]cn1)C(=O)O)[C@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)O

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

• • Target Organism

  • • Gram-negative bacterium:

      Target Organism	Activity
      Escherichia coli (MIC=100 µM);	-

    • Gram-positive bacterium:

      Target Organism	Activity
      Micrococcus luteus	MIC=100 µM

    • Fungi:

      Target Organism	Activity
      Fusarium graminearum spores	MIC=10 µM
      F;	-

    • Graminearum mycelia (MIC=280 µM), Fusarium oxysporum spores (MIC=100 µM), F. oxysporum mycelia (MIC=280 µM), Leptosphaeria maculans spores (MIC=100 µM).

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Linear

• • N-terminal Modification

  • Free

• • C-terminal Modification

  • Free

• • Nonterminal Modifications and Unusual Amino Acids

  • Free

• • Stereochemistry

  • L

• • Structure

  • Not found

• • Structure Description

  • Not found

• • PDB ID

• Predicted Structure

• There is no predicted structure for DRAMP03514.

DRAMP03514

• • Comment

  • No comments found on DRAMP database

• ·Literature 1

• • Title

  • The discovery and analysis of a diverged family of novel antifungal moricin-like peptides in the wax moth Galleria mellonella.

• • Pubmed ID

  • 18207081

• • Reference

  • Insect Biochem Mol Biol. 2008;38:201-212.

• • Author

  • Brown SE, Howard A, Kasprzak AB, Gordon KH, East PD.