General Information

    • DRAMP ID

    • DRAMP03537

    • Peptide Name

    • Lebocin-4 (Leb 4; Insects, animals)

    • Source

    • Bombyx mori (Silk moth)

    • Family

    • Belongs to the lebocin family

    • Gene

    • LEB4

    • Sequence

    • DLRFWNPREKLPLPTLPPFNPKPIYIDMGNRY

    • Sequence Length

    • 32

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03537 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03537.

Physicochemical Information

    • Formula

    • C184H277N47O45S

    • Absent Amino Acids

    • ACHQSV

    • Common Amino Acids

    • P

    • Mass

    • 3899.57

    • PI

    • 9.52

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +2

    • Boman Index

    • -61.78

    • Hydrophobicity

    • -0.825

    • Aliphatic Index

    • 73.13

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 273.55

    • Polar Residues

    • 7

DRAMP03537

DRAMP03537 chydropathy plot

Comments Information

    • Function

    • Antibacterial peptide.

    • Tissue specificity

    • Hemolymph. Produced in fat body.

    • Induction

    • By bacterial infection.

Literature Information

  • ·Literature 1

    • Title

    • A novel member of lebocin gene family from the silkworm, Bombyx mori.

    • Reference

    • Biochem. Biophys. Res. Commun. 1997; 238:769-774

    • Author

    • Furukawa S, Taniai K, Ishibashi J, Hara S, Shono T, Yamakawa M.