• DRAMP ID

    • DRAMP03538
    • Peptide Name

    • Cecropin (Antibacterial peptide CM-IV; Insects, animals)
    • Source

    • Bombyx mori (Silk moth)
    • Family

    • Belongs to the cecropin family
    • Gene

    • Not found
    • Sequence

    • RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI
    • Sequence Length

    • 35
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C172H290N50O44
    • Absent Amino Acids

    • CHLMSY
    • Common Amino Acids

    • AIKV
    • Mass

    • 3762.5
    • PI

    • 10.56
    • Basic Residues

    • 7
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 17
    • Net Charge

    • +5
    • Boman Index

    • -30.49
    • Hydrophobicity

    • 0.129
    • Aliphatic Index

    • 111.43
    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 5500
    • Absorbance 280nm

    • 161.76
    • Polar Residues

    • 6

DRAMP03538

    • Function

    • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.
  • ·Literature 1
    • Title

    • Cell-free immunity in insects.
    • Reference

    • Annu Rev Microbiol. 1987;41:103-126.
    • Author

    • Boman HG, Hultmark D.