• • DRAMP ID

  • DRAMP03538

• • Peptide Name

  • Cecropin (Antibacterial peptide CM-IV; Insects, animals)

• • Source

  • Bombyx mori (Silk moth)

• • Family

  • Belongs to the cecropin family

• • Gene

  • Not found

• • Sequence

  • RWKIFKKIEKVGQNIRDGIVKAGPAVAVVGQAATI

• • Sequence Length

  • 35

• • UniProt Entry

  • P14666

• • Protein Existence

  • Protein level

• • Biological Activity

  • Antimicrobial, Antibacterial

• • Target Organism

  • No MICs found in DRAMP database

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Not found

• • Structure Description

  • Not found

• • Helical Wheel Diagram

  • 

• • PDB ID

  • None

• Predicted Structure

• There is no predicted structure for DRAMP03538.

DRAMP03538

• • Function

  • Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

• ·Literature 1

• • Title

  • Cell-free immunity in insects.

• • Pubmed ID

  • 3318666

• • Reference

  • Annu Rev Microbiol. 1987;41:103-126.

• • Author

  • Boman HG, Hultmark D.