• DRAMP ID

    • DRAMP03591
    • Peptide Name

    • Neutrophil defensin 1 (Defensin, alpha 1; HNP-1, HP-1; Human, mammals, animals)
    • Source

    • Homo sapiens (Human)
    • Family

    • Belongs to the alpha-defensin family
    • Gene

    • DEFA1, DEFA1B
    • Sequence

    • ACYCRIPACIAGERRYGTCIYQGRLWAFCC
    • Sequence Length

    • 30
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal, Antiviral(SARS-CoV-2)
    • Target Organism

      • [Ref.34206990]Virus:
        Target OrganismActivity
        SARS-CoV-2:inhibition of infection in HEK293T-hACE2 cells(approximately 50% inbibition at 1 μg/mL (290 nM));SARS-CoV-2 variant P.1:inhibition of infection in HeLa-hACE2 cells(67% inbibition at 50 μg/mL);SARS-CoV-2 variant B.1.1.7:inhibition of infection in HeLa-hACE2 cells58% inbibition at 50 μg/mL
      • [Ref.15616305] Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli ATCC 8739vLD50=3.6±0.3 μg/ml
        E. coli ATCC 25922vLD50=3.7±0.4 μg/ml
        Enterobacter aerogenes ATCC 13048 (vLD50=10±0.5 μg/ml);-
      • Gram-positive bacteria:
        Target OrganismActivity
        Staphylococcus aureus ATCC 25923vLD50=4.2±1.0 μg/ml
        Staphylococcus aureus ATCC 29213vLD50=2.1±0.3 μg/ml
        Bacillus cereus ATCC 10876vLD50=0.22±0.03 μg/ml
      • NOTE:
        Target OrganismActivity
        vLD50-
        virtual lethal dosesvLDs
        equivalent to conventional 50% lethal dosesLD50s
      • [Ref.15118082]Gram-positive bacteria:
        Target OrganismActivity
        Bacillus subtilisInhibition zone=24 mm in PH5.5, Inhibition zone=20 mm in PH7.5 completely inhibit at 10 μg/well
        Staphylococcus aureus (Inhibition zone=1 mm in PH5.5, Inhibition zone=7 mm incompletely inhibit and Inhibition zone=2 mm completely inhibit in PH7.5 at 10 μg/well);-
      • Gram-negative bacteria:
        Target OrganismActivity
        Escherichia coli (Inhibition zone=5 mm incompletely inhibit and Inhibition zone=2 mm completely inhibit in PH7.5 at 10 μg/well);-
      • Fungi:
        Target OrganismActivity
        Candida albicansInhibition zone=13 mm in PH5.5, Inhibition zone=10 mm in PH7.5 completely inhibit at 10 μg/well
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • [Ref.34206990]No cytotoxicity on HEK293T cells up to 50 μg/mL.
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Cyclization(Cys2 and Cys30).
    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bonds between Cys2 and Cys30,Cys4 and Cys19,Cys9 and Cys29.
    • Stereochemistry

    • L
    • Structure

    • Beta strand
    • Structure Description

    • Compared to HNP-2, HNP-1 contains one additional residue (Ala) at the N-terminus. It contains a long stretch of a double-stranded antiparallel beta-sheet in a hairpin conformation that contains a beta-bulge, a short region of triple-stranded beta-sheet, and several tight turns.
    • PDB ID

    • 2KHT resolved by NMR
    • Predicted Structure

    • There is no predicted structure for DRAMP03591.
    • Formula

    • C150H228N44O38S6
    • Absent Amino Acids

    • DHKMNSV
    • Common Amino Acids

    • C
    • Mass

    • 3448.09
    • PI

    • 8.68
    • Basic Residues

    • 4
    • Acidic Residues

    • 1
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +3
    • Boman Index

    • -32.29
    • Hydrophobicity

    • 0.3
    • Aliphatic Index

    • 65.33
    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 10345
    • Absorbance 280nm

    • 356.72
    • Polar Residues

    • 13

DRAMP03591

    • Function

    • Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
    • PTM

    • ADP-ribosylation drastically reduces cytotoxic and antibacterial activities, and enhances IL8 production. Phosphorylation at Tyr-85 has been found in some cancer cell lines, and interferes with ADP-rybosylation.
  • ·Literature 1
    • Title

    • Human Defensins Inhibit SARS-CoV-2 Infection by Blocking Viral Entry.
    • Reference

    • Viruses. 2021 Jun 26;13(7):1246.
    • Author

    • Xu C, Wang A, Marin M, Honnen W, Ramasamy S, Porter E, Subbian S, Pinter A, Melikyan GB, Lu W, Chang TL.
  • ·Literature 2
    • Title

    • Isolation, purification and de novo sequencing of TBD-1, the first beta-defensin from leukocytes of reptiles.
    • Reference

    • Proteomics. 2009 Mar;9(5):1364-1373.
    • Author

    • Stegemann C, Kolobov A Jr, Leonova YF, Knappe D, Shamova O, Ovchinnikova TV, Kokryakov VN, Hoffmann R.
  • ·Literature 3
    • Title

    • Antibacterial activity and specificity of the six human {alpha}-defensins.
    • Reference

    • Antimicrob Agents Chemother. 2005 Jan;49(1):269-275.
    • Author

    • Ericksen B, Wu Z, Lu W, Lehrer RI.
  • ·Literature 4
    • Title

    • Multidimensional signatures in antimicrobial peptides.
    • Reference

    • Proc Natl Acad Sci U S A. 2004 May 11;101(19):7363-8.
    • Author

    • Yount NY, Yeaman MR.