General Information

    • DRAMP ID

    • DRAMP03654

    • Peptide Name

    • Gallinacin-6 (Gal 6; Beta-defensin 6; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • GAL6

    • Sequence

    • SPIHACRYQRGVCIPGPCRWPYYRVGSCGSGLKSCCVRNRWA

    • Sequence Length

    • 42

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria:
        Target OrganismActivity
        Salmonella typhimurium-
        Salmonella entiriditis-

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03654 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03654.

Physicochemical Information

    • Formula

    • C205H317N67O52S6

    • Absent Amino Acids

    • DEFMT

    • Common Amino Acids

    • CR

    • Mass

    • 4744.55

    • PI

    • 9.61

    • Basic Residues

    • 8

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +8

    • Boman Index

    • -78.39

    • Hydrophobicity

    • -0.343

    • Aliphatic Index

    • 53.33

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 15845

    • Absorbance 280nm

    • 386.46

    • Polar Residues

    • 19

DRAMP03654

DRAMP03654 chydropathy plot

Comments Information

    • Tissue specificity

    • Expressed in bone marrow, testis, ovary, lung and trachea. Expressed in the ovarian stroma, but not in the ovarian follicles. PTM

Literature Information

  • ·Literature 1

    • Title

    • The chicken host peptides, gallinacins 4, 7, and 9 have antimicrobial activity against Salmonella serovars.

    • Reference

    • Biochem Biophys Res Commun. 2007 Apr 27;356(1):169-174.

    • Author

    • Milona P, Townes CL, Bevan RM, Hall J.
  • ·Literature 2

    • Title

    • A genome-wide screen identifies a single beta-defensin gene cluster in the chicken: implications for the origin and evolution of mammalian defensins.

    • Reference

    • BMC Genomics. 2004 Aug 13;5(1):56.

    • Author

    • Xiao Y, Hughes AL, Ando J, Matsuda Y, Cheng JF, Skinner-Noble D, Zhang G.
  • ·Literature 3

    • Title

    • Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken.

    • Reference

    • Immunogenetics. 2004 Jun;56(3):170-177.

    • Author

    • Lynn DJ, Higgs R, Gaines S, Tierney J, James T, Lloyd AT, Fares MA, Mulcahy G, O'Farrelly C.
  • ·Literature 4

    • Title

    • Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response

    • Reference

    • Reproduction. 2007 Jan;133(1):127-133.

    • Author

    • Subedi K, Isobe N, Nishibori M, Yoshimura Y.