General Information

    • DRAMP ID

    • DRAMP03659

    • Peptide Name

    • Gallinacin-11 (Gal-11; Beta-defensin 11; Birds, animals)

    • Source

    • Gallus gallus (Chicken)

    • Family

    • Belongs to the beta-defensin family

    • Gene

    • GAL11

    • Sequence

    • LPRDTSRCVGYHGYCIRSKVCPKPFAAFGTCSWRQKTCCVDTTSDFHTCQDKGGHCVSPKIRCLEEQLGLCPLKRWTCCKEI

    • Sequence Length

    • 82

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacterium: Escherichia coli (MIC=50 nM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys8 and Cys38,Cys15 and Cys31, Cys21 and Cys39.

    • Stereochemistry

    • L

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03659 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP03659.

Physicochemical Information

    • Formula

    • C399H630N118O114S12

    • Absent Amino Acids

    • MN

    • Common Amino Acids

    • C

    • Mass

    • 9288.83

    • PI

    • 8.78

    • Basic Residues

    • 16

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +9

    • Boman Index

    • -155.81

    • Hydrophobicity

    • -0.382

    • Aliphatic Index

    • 54.63

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 14730

    • Absorbance 280nm

    • 181.85

    • Polar Residues

    • 32

DRAMP03659

DRAMP03659 chydropathy plot

Comments Information

    • Tissue specificity

    • Detected in outer membrane of the vitelline layer of the egg (at protein level). Expressed in the liver, gall bladder, kidney, testis, ovary and male and female reproductive tracts. Expressed in the ovarian stroma, but not in the ovarian follicles. No expression is detected in bone marrow. PTM

Literature Information

  • ·Literature 1

    • Title

    • Changes in the expression of gallinacins, antimicrobial peptides, in ovarian follicles during follicular growth and in response to lipopolysaccharide in laying hens (Gallus domesticus).

    • Reference

    • Reproduction. 2007 Jan;133(1):127-133.

    • Author

    • Subedi K, Isobe N, Nishibori M, Yoshimura Y.
  • ·Literature 2

    • Title

    • Isolation of a novel protein from the outer layer of the vitelline membrane.

    • Reference

    • Biochem J. 1992 Aug 15;286 (Pt 1):17-22.

    • Author

    • Kido S, Morimoto A, Kim F, Doi Y.