General Information

    • DRAMP ID

    • DRAMP03672

    • Peptide Name

    • Spodomicin (Insects, animals)

    • Source

    • Spodoptera littoralis

    • Family

    • Belongs to the diapausin family

    • Gene

    • Not found

    • Sequence

    • VHVGPCDQVCSRIDPEKDECCRAHGYRGHSSCYYGRMECY

    • Sequence Length

    • 40

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP03672 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP03672.

Physicochemical Information

    • Formula

    • C190H286N60O61S7

    • Absent Amino Acids

    • FLNTW

    • Common Amino Acids

    • C

    • Mass

    • 4611.15

    • PI

    • 6.27

    • Basic Residues

    • 8

    • Acidic Residues

    • 6

    • Hydrophobic Residues

    • 5

    • Net Charge

    • +2

    • Boman Index

    • -109.46

    • Hydrophobicity

    • -0.815

    • Aliphatic Index

    • 34

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6335

    • Absorbance 280nm

    • 162.44

    • Polar Residues

    • 17

DRAMP03672

DRAMP03672 chydropathy plot

Comments Information

    • Function

    • Fungicide.

    • Tissue specificity

    • Hemolymph.

    • Induction

    • By bacterial infection.

    • PTM

    • Contains three disulfide bonds.

Literature Information

  • ·Literature 1

    • Title

    • Unknown

    • Reference

    • Submitted (JUL-2003) to UniProtKB

    • Author

    • Bulet P, Lamberty M, Brookhart G, Bushey D.