• DRAMP ID

    • DRAMP03672
    • Peptide Name

    • Spodomicin (Insects, animals)
    • Source

    • Spodoptera littoralis
    • Family

    • Belongs to the diapausin family
    • Gene

    • Not found
    • Sequence

    • VHVGPCDQVCSRIDPEKDECCRAHGYRGHSSCYYGRMECY
    • Sequence Length

    • 40
    • Protein Existence

    • Protein level
    • SMILES

    • Not available
    • Biological Activity

    • Antimicrobial, Antifungal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • PDB ID

    • None
    • Predicted Structure

    • Formula

    • C190H286N60O61S7
    • Absent Amino Acids

    • FLNTW
    • Common Amino Acids

    • C
    • Mass

    • 4611.15
    • PI

    • 6.27
    • Basic Residues

    • 8
    • Acidic Residues

    • 6
    • Hydrophobic Residues

    • 5
    • Net Charge

    • +2
    • Boman Index

    • -109.46
    • Hydrophobicity

    • -0.815
    • Aliphatic Index

    • 34
    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 6335
    • Absorbance 280nm

    • 162.44
    • Polar Residues

    • 17

DRAMP03672

    • Function

    • Fungicide.
    • Tissue specificity

    • Hemolymph.
    • Induction

    • By bacterial infection.
    • PTM

    • Contains three disulfide bonds.
  • ·Literature 1
    • Title

    • Unknown
    • Reference

    • Submitted (JUL-2003) to UniProtKB
    • Author

    • Bulet P, Lamberty M, Brookhart G, Bushey D.